From 4cb3fa6de434d287bb46ca94c3026880164cb774 Mon Sep 17 00:00:00 2001 From: Shivesh Mandalia Date: Sun, 5 Feb 2023 01:32:03 +0000 Subject: complete day 6 and 7 --- cabal.project | 2 +- day04/examples/input.txt | 1000 ---------------------------------------------- day04/examples/test.txt | 6 - day05/app/Main.hs | 235 +++++++++++ day05/day05.cabal | 34 ++ day05/examples/input.txt | 513 ++++++++++++++++++++++++ day05/examples/test.txt | 9 + day06/app/Main.hs | 154 +++++++ day06/day06.cabal | 35 ++ day06/examples/input.txt | 1 + day06/examples/test0.txt | 1 + day06/examples/test1.txt | 1 + day06/examples/test2.txt | 1 + day06/examples/test3.txt | 1 + day06/examples/test4.txt | 1 + day07/app/Main.hs | 259 ++++++++++++ day07/day07.cabal | 35 ++ day07/examples/input.txt | 979 +++++++++++++++++++++++++++++++++++++++++++++ day07/examples/test.txt | 23 ++ 19 files changed, 2283 insertions(+), 1007 deletions(-) delete mode 100644 day04/examples/input.txt delete mode 100644 day04/examples/test.txt create mode 100644 day05/app/Main.hs create mode 100644 day05/day05.cabal create mode 100644 day05/examples/input.txt create mode 100644 day05/examples/test.txt create mode 100644 day06/app/Main.hs create mode 100644 day06/day06.cabal create mode 100644 day06/examples/input.txt create mode 100644 day06/examples/test0.txt create mode 100644 day06/examples/test1.txt create mode 100644 day06/examples/test2.txt create mode 100644 day06/examples/test3.txt create mode 100644 day06/examples/test4.txt create mode 100644 day07/app/Main.hs create mode 100644 day07/day07.cabal create mode 100644 day07/examples/input.txt create mode 100644 day07/examples/test.txt diff --git a/cabal.project b/cabal.project index 63f8a15..6a0c239 100644 --- a/cabal.project +++ b/cabal.project @@ -1,2 +1,2 @@ -- Local packages -packages: day01, day02, day03, day04 +packages: day01, day02, day03, day04, day05, day06, day07 diff --git a/day04/examples/input.txt b/day04/examples/input.txt deleted file mode 100644 index bab3d4d..0000000 --- a/day04/examples/input.txt +++ /dev/null @@ -1,1000 +0,0 @@ -14-50,14-50 -43-44,43-87 -55-99,51-96 -67-68,68-91 -8-8,27-73 -22-92,21-92 -4-80,3-80 -10-67,34-67 -49-56,49-89 -27-96,27-28 -30-47,29-47 -75-75,16-74 -50-70,47-63 -9-89,10-88 -1-69,16-68 -9-76,52-76 -4-96,98-98 -28-66,11-29 -47-60,46-47 -37-88,36-88 -37-98,37-99 -9-88,87-88 -2-8,2-3 -29-98,29-46 -12-98,12-83 -85-99,19-98 -5-37,37-37 -52-99,52-99 -50-76,27-75 -57-59,29-58 -6-71,71-74 -61-77,62-77 -76-76,16-75 -3-27,4-27 -1-2,1-46 -4-74,4-73 -71-99,13-70 -29-92,30-92 -59-59,58-58 -49-54,50-51 -3-85,69-86 -26-76,66-66 -14-97,9-97 -43-44,7-45 -54-54,37-54 -2-91,4-68 -43-84,78-83 -4-97,3-97 -8-42,13-97 -26-95,2-16 -25-68,25-68 -4-57,3-62 -23-85,23-24 -68-78,32-74 -27-70,34-70 -6-70,69-71 -54-56,5-55 -21-54,21-54 -8-85,7-8 -46-57,45-63 -77-79,26-78 -9-37,8-37 -7-66,66-67 -76-93,93-93 -20-73,21-74 -12-13,12-14 -77-97,77-97 -12-92,13-13 -85-85,82-86 -80-91,18-74 -1-96,1-99 -29-31,30-30 -78-94,77-77 -32-45,3-58 -15-76,15-76 -49-73,73-97 -12-73,19-73 -95-95,22-94 -13-67,13-19 -4-5,6-99 -60-62,4-61 -16-54,16-55 -88-92,90-93 -33-40,40-86 -72-94,49-71 -4-94,5-48 -1-37,1-37 -18-84,83-84 -64-77,77-78 -93-93,92-93 -25-94,95-95 -10-41,6-41 -66-89,69-86 -21-97,22-97 -60-74,2-60 -39-60,54-59 -29-74,73-73 -44-61,43-61 -10-80,11-80 -79-80,4-83 -3-7,8-98 -40-47,48-68 -73-85,73-86 -72-85,73-85 -3-95,94-99 -63-64,11-64 -41-60,36-42 -2-45,6-10 -42-45,41-58 -9-77,73-75 -48-55,13-54 -23-33,23-24 -92-92,16-91 -83-97,84-97 -93-97,2-94 -34-80,33-62 -37-92,87-93 -67-67,32-67 -1-72,7-71 -57-85,86-88 -53-56,50-53 -97-99,3-98 -3-6,8-93 -22-81,22-99 -53-77,53-53 -97-99,3-98 -35-55,35-55 -30-30,30-95 -27-94,28-37 -30-68,57-79 -30-84,83-85 -16-22,14-21 -95-95,2-95 -34-45,35-51 -16-36,12-17 -3-3,3-95 -8-77,6-78 -4-89,6-86 -77-83,76-88 -43-43,37-42 -41-62,44-97 -67-86,85-87 -82-96,99-99 -75-92,80-83 -12-29,12-29 -82-94,18-81 -9-93,97-97 -83-93,79-84 -90-97,17-90 -29-32,22-31 -14-48,3-81 -72-84,63-84 -7-98,6-97 -6-83,6-82 -6-83,58-93 -2-62,11-80 -77-77,76-82 -36-37,36-60 -1-84,7-83 -10-48,32-72 -2-51,25-48 -22-96,18-99 -99-99,55-95 -5-59,1-60 -65-70,4-69 -10-91,10-90 -6-98,1-7 -83-90,88-91 -39-39,24-38 -34-87,4-35 -86-88,15-85 -44-52,43-44 -1-81,53-99 -85-88,85-99 -87-87,63-87 -96-99,1-96 -20-22,21-23 -32-57,33-56 -4-89,4-90 -16-81,17-52 -83-99,16-84 -14-21,15-16 -38-80,79-86 -60-81,59-99 -90-93,15-89 -2-74,75-78 -3-91,18-67 -22-91,22-22 -16-19,18-83 -9-81,10-91 -2-98,2-49 -93-94,77-94 -28-92,11-93 -36-99,36-97 -32-48,48-48 -11-14,15-71 -5-81,5-56 -23-61,23-24 -92-94,23-93 -3-40,7-98 -28-98,99-99 -2-62,50-63 -20-43,18-18 -38-51,50-51 -3-11,37-46 -8-95,2-7 -96-98,23-73 -73-92,73-73 -96-99,1-97 -2-83,83-88 -12-73,99-99 -13-86,12-87 -87-87,23-87 -95-96,40-71 -18-42,18-92 -29-61,23-62 -59-97,58-93 -35-74,34-75 -8-94,9-95 -15-65,76-82 -26-89,16-97 -53-71,11-85 -5-51,3-51 -21-43,22-76 -33-33,23-32 -10-29,9-30 -87-88,87-96 -2-50,3-51 -23-83,22-87 -15-96,95-97 -10-77,9-78 -67-95,67-95 -17-18,18-64 -2-9,8-83 -8-51,50-51 -92-92,2-92 -6-16,5-15 -32-47,37-49 -15-81,75-96 -34-75,49-71 -6-71,6-71 -15-92,91-92 -43-91,43-91 -50-78,49-77 -35-56,55-55 -45-77,76-77 -9-76,9-91 -7-88,7-88 -51-72,50-51 -21-98,7-44 -35-89,35-89 -17-87,4-87 -60-75,61-61 -92-96,45-93 -47-59,46-58 -4-97,1-28 -38-39,37-39 -9-63,24-84 -8-94,14-93 -49-86,58-85 -10-13,8-42 -98-98,41-93 -25-75,26-92 -5-80,79-81 -6-56,23-56 -17-94,94-94 -87-87,34-87 -55-57,55-69 -48-80,37-47 -99-99,2-99 -38-57,37-56 -63-86,62-86 -97-97,24-98 -18-61,17-60 -10-68,6-42 -86-86,11-86 -9-24,24-24 -17-73,72-72 -12-97,13-98 -5-83,29-84 -5-45,79-95 -36-36,51-86 -3-63,2-86 -1-65,17-36 -7-7,6-9 -5-5,5-99 -8-48,7-46 -3-83,1-84 -28-76,29-77 -65-94,3-95 -14-53,15-50 -1-29,15-41 -9-86,9-94 -30-97,29-48 -74-86,78-83 -2-17,3-17 -83-83,29-82 -16-76,96-96 -3-63,4-63 -2-98,2-98 -15-98,14-97 -2-13,14-62 -31-76,75-77 -97-97,28-98 -87-87,82-87 -37-45,38-46 -17-39,21-42 -23-67,43-62 -3-43,3-4 -67-91,67-80 -10-91,10-11 -1-97,6-97 -29-97,99-99 -78-78,18-77 -5-98,6-98 -49-86,87-96 -6-84,7-7 -1-92,1-92 -33-51,24-32 -15-85,2-86 -67-86,67-92 -4-78,6-90 -15-92,8-92 -12-93,94-99 -12-67,32-96 -73-95,74-96 -35-45,35-42 -68-69,67-77 -16-70,7-16 -84-86,21-85 -12-19,5-18 -82-94,94-95 -8-27,28-28 -55-93,11-93 -31-86,98-99 -41-65,41-64 -56-76,31-57 -15-41,7-41 -92-94,7-93 -5-24,25-39 -5-25,24-24 -3-3,3-20 -52-92,91-91 -16-94,16-95 -3-85,1-86 -38-90,38-90 -35-36,35-98 -7-18,7-8 -12-35,12-36 -6-89,31-33 -37-56,40-67 -1-98,1-99 -2-96,2-99 -13-49,13-19 -9-99,51-77 -3-87,74-88 -69-69,17-69 -39-98,38-43 -20-42,19-57 -57-99,35-56 -90-98,89-89 -9-71,8-70 -5-72,5-38 -37-91,4-37 -46-87,10-93 -9-78,8-77 -58-58,11-59 -8-13,14-95 -76-84,75-83 -27-77,1-27 -17-96,14-55 -50-55,33-55 -86-99,86-92 -58-81,81-81 -88-88,70-88 -36-36,18-36 -57-59,11-58 -5-6,6-15 -94-97,39-94 -27-63,27-80 -35-57,36-58 -4-83,8-83 -84-91,15-64 -10-43,44-79 -51-51,16-51 -4-97,5-98 -10-36,22-29 -3-90,56-87 -63-90,83-98 -53-75,52-74 -89-96,29-88 -66-99,21-98 -14-19,19-86 -27-27,26-65 -75-82,18-76 -11-95,94-98 -77-78,78-90 -13-15,14-72 -11-88,25-88 -23-23,22-46 -32-41,33-78 -54-90,39-60 -14-71,15-68 -3-95,95-95 -29-73,72-73 -20-33,20-33 -33-61,33-85 -15-92,15-95 -7-77,43-68 -50-55,54-55 -38-65,38-64 -43-68,54-77 -15-58,15-51 -2-38,3-46 -36-36,36-73 -9-70,10-71 -79-83,82-88 -55-86,55-55 -19-57,18-60 -26-31,27-76 -14-66,3-13 -94-97,2-95 -10-98,21-94 -20-44,21-44 -47-99,46-99 -13-31,21-24 -1-99,99-99 -17-92,53-93 -54-74,53-74 -8-16,16-98 -10-98,10-99 -18-67,68-89 -38-77,76-85 -26-66,25-67 -9-35,35-94 -10-43,11-44 -69-92,4-38 -48-84,15-49 -5-50,23-51 -9-27,27-71 -21-99,21-21 -4-97,97-99 -41-53,2-52 -11-66,2-57 -32-75,16-31 -7-59,6-58 -45-97,93-96 -14-71,10-71 -50-98,37-49 -29-76,77-77 -78-80,79-80 -23-30,22-30 -4-5,4-98 -17-35,35-36 -16-42,42-43 -50-92,19-51 -29-57,29-56 -27-75,3-80 -10-62,62-62 -48-76,24-49 -71-73,2-72 -38-42,40-41 -24-74,25-30 -4-22,1-21 -6-47,6-46 -31-36,31-85 -6-98,8-98 -98-99,52-98 -34-90,49-91 -44-88,45-89 -33-94,94-95 -6-91,3-6 -6-8,5-87 -8-97,75-98 -45-75,94-94 -60-80,60-99 -97-97,30-98 -15-16,15-79 -40-67,63-96 -24-94,22-93 -6-57,8-57 -8-97,97-97 -83-83,44-78 -13-17,20-95 -8-56,56-87 -7-96,1-96 -21-88,22-82 -2-44,2-44 -10-93,14-66 -10-98,10-82 -4-55,1-1 -4-5,4-98 -21-29,28-29 -67-82,24-33 -26-99,26-27 -46-74,73-74 -83-83,71-83 -33-52,23-53 -53-89,30-52 -35-67,51-67 -24-87,86-98 -21-96,21-64 -92-93,30-92 -32-41,41-94 -99-99,6-97 -98-99,4-95 -3-74,2-74 -50-50,20-51 -4-19,18-18 -8-94,3-95 -23-84,59-65 -34-75,74-74 -57-92,17-94 -40-42,41-84 -29-62,29-97 -94-97,99-99 -66-70,66-71 -98-99,22-99 -26-72,26-55 -11-66,11-94 -8-91,8-87 -50-74,44-88 -71-76,71-72 -1-65,1-65 -61-89,1-88 -8-12,8-15 -92-94,14-92 -4-95,1-95 -24-96,24-90 -34-75,27-74 -13-77,18-94 -21-89,13-90 -10-96,9-10 -43-56,24-56 -9-14,9-10 -3-95,31-95 -36-52,43-46 -29-44,44-96 -20-96,13-97 -45-78,36-84 -8-72,9-72 -96-99,42-97 -14-75,76-76 -48-71,61-72 -18-78,17-77 -4-37,2-2 -9-98,4-8 -29-51,49-52 -67-80,52-80 -24-24,22-57 -11-80,11-80 -19-22,79-86 -47-87,47-87 -58-70,58-71 -44-67,44-54 -2-63,2-96 -8-28,7-70 -3-20,20-21 -35-69,69-95 -2-18,1-18 -4-92,91-93 -31-70,31-71 -46-48,11-47 -75-77,23-76 -78-78,24-77 -8-71,8-13 -19-85,26-73 -64-82,88-99 -30-74,4-74 -3-15,1-15 -44-57,43-45 -36-99,35-96 -14-84,8-84 -2-84,11-80 -19-36,37-37 -38-61,60-85 -28-76,27-29 -63-65,52-64 -84-86,1-85 -45-45,9-45 -5-71,3-96 -42-44,35-45 -41-72,41-73 -4-62,2-51 -14-29,14-29 -10-11,11-91 -95-95,1-96 -6-80,5-78 -31-68,69-87 -5-80,80-81 -5-91,8-68 -15-86,98-99 -49-88,49-84 -4-15,16-73 -31-79,64-65 -85-85,5-85 -21-47,17-20 -13-87,25-78 -94-94,1-93 -4-96,3-96 -22-61,6-61 -3-85,2-80 -16-17,17-66 -23-67,67-67 -13-83,55-83 -97-97,63-98 -17-62,17-17 -43-61,44-80 -47-56,52-59 -48-87,87-96 -49-50,75-88 -5-95,5-95 -5-72,7-71 -16-51,50-51 -25-80,11-79 -23-91,24-91 -94-96,48-95 -17-99,17-17 -3-68,67-68 -15-84,9-85 -29-87,26-87 -88-91,87-96 -6-70,69-70 -40-58,34-43 -19-98,39-98 -3-96,3-95 -38-86,85-88 -32-71,47-63 -62-88,14-99 -24-54,94-95 -14-26,15-15 -29-86,19-87 -7-83,10-84 -4-95,96-96 -45-55,45-54 -9-71,27-93 -27-85,45-85 -32-79,2-77 -34-79,20-78 -8-20,12-20 -5-6,6-91 -14-34,14-35 -19-67,73-74 -5-95,5-96 -23-96,3-23 -30-51,15-52 -39-52,35-51 -45-45,28-44 -8-15,16-16 -3-90,2-75 -36-84,36-84 -86-97,86-97 -20-93,67-92 -18-43,16-90 -1-12,13-98 -12-93,11-50 -15-79,15-93 -77-82,59-78 -31-92,32-93 -27-79,28-90 -4-76,32-85 -26-46,45-45 -85-89,85-96 -28-43,28-95 -37-97,20-96 -2-64,64-64 -46-51,47-87 -82-88,7-82 -14-48,44-46 -25-99,25-25 -31-31,30-71 -23-89,88-90 -55-83,38-92 -19-67,11-68 -16-32,17-71 -59-79,79-81 -28-95,23-28 -86-96,11-87 -20-46,31-49 -5-6,5-49 -15-79,15-90 -95-97,3-96 -17-19,18-57 -56-82,57-98 -92-92,47-91 -88-89,89-91 -97-98,6-96 -7-89,8-63 -49-85,2-50 -74-75,62-75 -14-35,15-35 -11-64,5-46 -2-6,5-83 -58-95,28-81 -28-73,29-29 -84-93,30-83 -41-97,97-98 -22-48,22-48 -54-90,76-90 -88-99,8-89 -67-94,68-68 -51-55,51-90 -40-58,44-89 -60-78,60-77 -23-69,23-85 -34-85,35-86 -87-99,16-75 -34-96,96-98 -39-72,12-72 -25-92,92-94 -8-73,73-82 -12-92,13-95 -30-92,55-98 -37-37,10-38 -31-38,34-34 -54-88,2-85 -12-42,41-41 -5-97,96-97 -82-82,20-83 -3-24,1-24 -20-96,96-96 -33-99,34-54 -26-93,26-37 -21-58,21-58 -61-86,2-47 -5-65,4-98 -2-66,2-99 -64-66,15-65 -11-75,2-58 -55-75,47-93 -37-58,36-58 -21-71,21-71 -45-92,40-58 -18-40,37-43 -33-65,33-65 -43-84,91-93 -13-13,13-80 -30-84,31-72 -38-98,39-98 -42-88,91-98 -10-91,9-10 -56-66,67-94 -55-87,54-78 -9-96,9-95 -18-63,7-64 -9-28,27-29 -32-67,16-68 -1-9,15-45 -34-44,34-80 -98-98,89-99 -9-68,10-96 -42-43,26-43 -82-90,91-93 -21-21,11-21 -7-58,5-95 -93-95,60-93 -7-40,8-94 -25-26,26-96 -8-98,7-98 -23-87,24-87 -9-51,10-48 -21-99,18-98 -32-79,7-55 -2-99,1-99 -11-85,3-85 -2-85,1-85 -21-83,59-70 -33-33,32-34 -21-60,22-43 -14-29,14-28 -35-55,34-54 -50-59,50-50 -39-68,67-85 -14-21,6-79 -26-47,47-87 -2-82,82-89 -46-55,46-47 -6-86,87-87 -60-60,8-64 -27-28,28-79 -1-2,1-98 -11-85,84-89 -12-27,20-21 -6-93,9-90 -6-92,2-98 -77-86,25-76 -37-62,79-82 -69-97,36-96 -7-92,99-99 -73-73,32-74 -92-97,62-95 -41-96,51-96 -22-97,34-96 -25-26,26-50 -11-86,12-87 -68-84,4-82 -14-87,46-86 -28-30,29-68 -1-68,2-45 -6-92,5-94 -2-28,36-77 -5-11,5-24 -35-91,29-91 -40-93,7-94 -70-96,10-69 -67-96,10-66 -67-67,67-67 -1-63,3-63 -9-95,8-95 -78-78,37-79 -47-48,47-79 -14-93,14-14 -24-96,31-96 -29-29,6-30 -60-67,60-67 -80-80,2-81 -24-85,30-84 -66-73,72-82 -58-97,59-97 -9-9,9-95 -21-42,22-42 -5-35,3-6 -39-98,97-98 -85-96,44-97 -65-98,11-97 -2-94,2-95 -64-96,66-97 -2-99,2-95 -32-51,32-43 -4-11,11-40 -1-64,1-1 -89-96,19-88 -11-32,12-17 -5-98,5-98 -17-98,16-96 -18-71,17-98 -37-75,37-71 -37-92,37-92 -7-88,38-76 -3-13,12-52 -6-96,7-97 -91-99,2-90 -30-95,30-31 -9-27,9-59 -72-78,39-72 -23-30,27-84 -75-92,26-74 -30-36,31-35 -55-55,24-54 -32-71,32-33 -6-88,87-96 -16-97,15-96 -44-81,81-98 -63-92,40-64 -70-70,14-71 -33-59,34-36 -13-26,13-62 -64-86,2-85 -38-90,37-90 -71-80,16-81 -10-41,17-97 -11-74,10-74 -88-96,85-89 -3-64,1-65 -71-79,78-95 -25-39,25-40 -18-98,2-99 -42-43,43-66 -2-90,3-91 -8-86,86-94 -10-97,98-99 -3-99,13-51 -35-84,72-84 -26-27,13-27 -10-71,2-87 -71-82,72-80 -60-87,28-64 -58-79,44-78 -1-98,2-98 -28-99,26-50 -12-77,27-76 -5-57,56-56 -29-43,29-43 -41-86,10-41 -45-69,44-69 -14-91,15-91 -42-57,62-73 -24-30,24-26 -57-64,62-65 -14-47,14-15 -3-88,79-89 -2-4,4-80 -54-90,10-89 -6-47,6-47 -66-68,65-70 -82-85,9-84 -73-91,73-79 -83-96,16-82 -93-96,41-72 -6-41,40-81 -7-53,3-7 -85-96,84-89 -9-20,10-71 -25-44,43-45 -2-99,99-99 -7-95,8-96 -50-53,49-53 -9-26,10-26 -3-50,47-50 -40-59,60-60 -66-71,72-72 -3-74,1-75 -43-79,25-80 -29-30,29-31 -8-50,58-68 -41-96,42-96 -62-64,62-81 -4-88,5-88 -2-93,2-92 -57-58,58-88 -56-84,31-80 -90-91,4-90 -8-72,40-73 -41-76,41-53 -57-57,5-62 -20-40,19-39 -74-77,21-80 -1-64,4-97 -13-48,48-88 -21-28,4-28 -14-16,14-14 -9-24,5-25 -20-67,17-18 -66-81,67-98 -22-61,23-57 -31-67,66-67 -14-75,74-76 -12-95,13-97 -49-51,1-50 -1-74,12-75 -4-93,94-94 -76-80,98-99 -74-79,78-80 -35-79,22-80 -30-89,88-89 -31-77,31-94 -73-90,89-94 -7-83,7-98 -5-98,4-6 -4-99,96-98 -19-75,18-75 -9-99,9-99 -69-75,6-68 -48-69,47-85 -7-80,6-87 -28-35,7-99 -59-60,41-59 -28-64,27-64 -5-97,1-73 -33-88,89-94 -20-98,10-98 -9-12,10-83 -11-73,74-90 -28-86,85-87 -14-56,56-90 -47-98,46-98 -11-83,82-83 -16-46,45-47 -98-98,1-98 -32-72,33-41 -3-62,2-62 -47-48,25-47 -12-46,5-46 -10-78,10-10 -18-95,4-94 -24-81,9-70 -6-98,90-97 -3-55,38-60 -55-68,55-67 -22-80,22-82 -6-70,7-7 -13-15,12-18 -54-95,38-89 -19-93,42-93 -65-92,93-97 -50-93,50-63 -50-99,50-99 -49-49,3-48 -4-54,4-54 -48-49,49-80 -1-4,3-3 -66-98,17-67 -56-70,55-93 -51-95,51-51 -64-73,37-65 -21-72,37-76 -45-73,46-73 -35-38,36-39 -17-36,17-37 -98-98,17-99 diff --git a/day04/examples/test.txt b/day04/examples/test.txt deleted file mode 100644 index 9f9e9cf..0000000 --- a/day04/examples/test.txt +++ /dev/null @@ -1,6 +0,0 @@ -2-4,6-8 -2-3,4-5 -5-7,7-9 -2-8,3-7 -6-6,4-6 -2-6,4-8 diff --git a/day05/app/Main.hs b/day05/app/Main.hs new file mode 100644 index 0000000..b56e45b --- /dev/null +++ b/day05/app/Main.hs @@ -0,0 +1,235 @@ +{- +--- Day 5: Supply Stacks --- + +The expedition can depart as soon as the final supplies have been unloaded from the +ships. Supplies are stored in stacks of marked crates, but because the needed supplies are +buried under many other crates, the crates need to be rearranged. + +The ship has a giant cargo crane capable of moving crates between stacks. To ensure none of +the crates get crushed or fall over, the crane operator will rearrange them in a series of +carefully-planned steps. After the crates are rearranged, the desired crates will be at the +top of each stack. + +The Elves don't want to interrupt the crane operator during this delicate procedure, but they +forgot to ask her which crate will end up where, and they want to be ready to unload them as +soon as possible so they can embark. + +They do, however, have a drawing of the starting stacks of crates and the rearrangement +procedure (your puzzle input). For example: + + [D] +[N] [C] +[Z] [M] [P] + 1 2 3 + +move 1 from 2 to 1 +move 3 from 1 to 3 +move 2 from 2 to 1 +move 1 from 1 to 2 + +In this example, there are three stacks of crates. Stack 1 contains two crates: crate Z is on +the bottom, and crate N is on top. Stack 2 contains three crates; from bottom to top, they are +crates M, C, and D. Finally, stack 3 contains a single crate, P. + +Then, the rearrangement procedure is given. In each step of the procedure, a quantity of +crates is moved from one stack to a different stack. In the first step of the above +rearrangement procedure, one crate is moved from stack 2 to stack 1, resulting in this +configuration: + +[D] +[N] [C] +[Z] [M] [P] + 1 2 3 + +In the second step, three crates are moved from stack 1 to stack 3. Crates are moved one at a +time, so the first crate to be moved (D) ends up below the second and third crates: + + [Z] + [N] + [C] [D] + [M] [P] + 1 2 3 + +Then, both crates are moved from stack 2 to stack 1. Again, because crates are moved one at a +time, crate C ends up below crate M: + + [Z] + [N] +[M] [D] +[C] [P] + 1 2 3 + +Finally, one crate is moved from stack 1 to stack 2: + + [Z] + [N] + [D] +[C] [M] [P] + 1 2 3 + +The Elves just need to know which crate will end up on top of each stack; in this example, the +top crates are C in stack 1, M in stack 2, and Z in stack 3, so you should combine these +together and give the Elves the message CMZ. + +After the rearrangement procedure completes, what crate ends up on top of each stack? + +--- Part Two --- + +As you watch the crane operator expertly rearrange the crates, you notice the process isn't +following your prediction. + +Some mud was covering the writing on the side of the crane, and you quickly wipe it away. The +crane isn't a CrateMover 9000 - it's a CrateMover 9001. + +The CrateMover 9001 is notable for many new and exciting features: air conditioning, leather +seats, an extra cup holder, and the ability to pick up and move multiple crates at once. + +Again considering the example above, the crates begin in the same configuration: + +``` + [D] +[N] [C] +[Z] [M] [P] + 1 2 3 +``` + +Moving a single crate from stack 2 to stack 1 behaves the same as before: + +``` +[D] +[N] [C] +[Z] [M] [P] + 1 2 3 +``` + +However, the action of moving three crates from stack 1 to stack 3 means that those three moved +crates stay in the same order, resulting in this new configuration: + +``` + [D] + [N] + [C] [Z] + [M] [P] + 1 2 3 +``` + +Next, as both crates are moved from stack 2 to stack 1, they retain their order as well: + +``` + [D] + [N] +[C] [Z] +[M] [P] + 1 2 3 +``` + +Finally, a single crate is still moved from stack 1 to stack 2, but now it's crate C that gets moved: + +``` + [D] + [N] + [Z] +[M] [C] [P] + 1 2 3 +``` + +In this example, the CrateMover 9001 has put the crates in a totally different order: MCD. + +Before the rearrangement process finishes, update your simulation so that the Elves know where +they should stand to be ready to unload the final supplies. After the rearrangement procedure +completes, what crate ends up on top of each stack? +-} +{-# LANGUAGE DerivingStrategies #-} + +module Main (main) where + +import Data.ByteString.Lazy (ByteString) +import Data.Char (digitToInt) +import Options.Applicative (Parser, ParserInfo, argument, execParser, fullDesc, help, helper, info, metavar, str) +import Relude hiding (ByteString, elem, empty, filter, fromList, length, null, optional, readFile, splitAt) +import Text.Parsec (ParseError, parse, ()) +import Text.Parsec.ByteString.Lazy (GenParser) +import Text.Parsec.Char (char, digit, string, upper) +import Text.Parsec.Combinator (eof, many1, sepBy1, sepEndBy1) +import Text.Parsec.Prim (parsecMap, try) + +type Opts :: Type +newtype Opts = Opts {_filename :: Text} deriving stock (Show) + +type Supplies :: Type +newtype Supplies = Supplies {_i :: [[Char]]} deriving stock (Show) + +type Order :: Type +data Order = Order {_amount :: Int, _from :: Int, _to :: Int} deriving stock (Show) + +parseInput :: FilePath -> ByteString -> Either ParseError (Supplies, [Order]) +parseInput = parse $ (,) <$> (supplies <* eol) <*> orders + where + supplies :: GenParser t st Supplies + supplies = Supplies <$> many1 (lineBlock <* eol) <* axis + + lineBlock :: GenParser t st [Char] + lineBlock = block `sepBy1` space + + block :: GenParser t st Char + block = (char '[' *> upper <* char ']') <|> (' ' <$ try (string " ")) + + axis :: GenParser t st [()] + axis = void space *> (void int `sepEndBy1` spaces) <* eol + + orders :: GenParser t st [Order] + orders = many1 order + + order :: GenParser t st Order + order = + Order + <$> (string "move " *> int) + <*> (string " from " *> int) + <*> (string " to " *> int <* (eol <|> eof)) + + space :: GenParser t st Char + space = char ' ' + + spaces :: GenParser t st [Char] + spaces = many1 space + + int :: GenParser t st Int + int = foldl' (\a i -> a * 10 + digitToInt i) 0 <$> many1 digit + + eol :: GenParser t st () + eol = + parsecMap + (const ()) + ( try (string "\n\r") + <|> try (string "\r\n") + <|> string "\n" + <|> string "\r" + "end of line" + ) + +runPart1 :: (Supplies, [Order]) -> (Supplies, [Order]) +runPart1 x = x + +runPart2 :: (Supplies, [Order]) -> Int +runPart2 = undefined + +main :: IO () +main = do + fileName <- toString . _filename <$> execParser opts + rawInput <- readFileLBS fileName + case parseInput fileName rawInput of + Left e -> do + putTextLn "Error parsing input:" + print e + Right r -> do + print $ runPart1 r + print $ runPart2 r + where + opts :: ParserInfo Opts + opts = info (helper <*> options) fullDesc + + options :: Parser Opts + options = Opts <$> filename + + filename :: Parser Text + filename = argument str $ metavar "filename" <> help "Input file" diff --git a/day05/day05.cabal b/day05/day05.cabal new file mode 100644 index 0000000..0923420 --- /dev/null +++ b/day05/day05.cabal @@ -0,0 +1,34 @@ +cabal-version: 2.4 +name: day05 +version: 0.1.0.0 +synopsis: + +-- A URL where users can report bugs. +-- bug-reports: +license: +author: Shivesh Mandalia +maintainer: mail@shivesh.org + +executable day05 + main-is: Main.hs + + -- Modules included in this executable, other than Main. + -- other-modules: + + -- LANGUAGE extensions used by modules in this package. + default-extensions: + NoImplicitPrelude + OverloadedStrings + StandaloneKindSignatures + + build-depends: + , base ^>=4.16.4.0 + , optparse-applicative >=0.17.0.0 + , parsec >=3.1.16.1 + , relude ^>=1.1.0.0 + + hs-source-dirs: app + default-language: Haskell2010 + ghc-options: + -Weverything -Wno-unused-packages -Wno-missing-safe-haskell-mode + -Wno-safe -Wno-missing-import-lists diff --git a/day05/examples/input.txt b/day05/examples/input.txt new file mode 100644 index 0000000..ca57552 --- /dev/null +++ b/day05/examples/input.txt @@ -0,0 +1,513 @@ +[C] [S] [H] +[F] [B] [C] [S] [W] +[B] [W] [W] [M] [S] [B] +[L] [H] [G] [L] [P] [F] [Q] +[D] [P] [J] [F] [T] [G] [M] [T] +[P] [G] [B] [N] [L] [W] [P] [W] [R] +[Z] [V] [W] [J] [J] [C] [T] [S] [C] +[S] [N] [F] [G] [W] [B] [H] [F] [N] + 1 2 3 4 5 6 7 8 9 + +move 2 from 5 to 9 +move 3 from 1 to 7 +move 2 from 3 to 9 +move 6 from 9 to 5 +move 2 from 3 to 8 +move 9 from 7 to 8 +move 15 from 8 to 9 +move 3 from 1 to 6 +move 6 from 4 to 2 +move 6 from 5 to 6 +move 1 from 4 to 2 +move 14 from 6 to 2 +move 2 from 1 to 5 +move 1 from 7 to 3 +move 1 from 4 to 8 +move 2 from 5 to 6 +move 25 from 2 to 4 +move 2 from 6 to 4 +move 1 from 8 to 1 +move 2 from 9 to 1 +move 1 from 6 to 1 +move 2 from 1 to 7 +move 1 from 7 to 3 +move 2 from 1 to 8 +move 1 from 2 to 6 +move 1 from 3 to 8 +move 4 from 5 to 6 +move 1 from 5 to 3 +move 1 from 9 to 6 +move 2 from 3 to 4 +move 1 from 2 to 6 +move 12 from 9 to 7 +move 1 from 9 to 1 +move 1 from 5 to 8 +move 1 from 3 to 8 +move 28 from 4 to 5 +move 1 from 4 to 3 +move 1 from 2 to 6 +move 1 from 3 to 9 +move 12 from 7 to 2 +move 1 from 9 to 6 +move 6 from 6 to 4 +move 1 from 7 to 4 +move 1 from 1 to 2 +move 28 from 5 to 1 +move 2 from 2 to 8 +move 3 from 8 to 2 +move 7 from 4 to 1 +move 4 from 8 to 6 +move 9 from 2 to 8 +move 7 from 6 to 5 +move 3 from 5 to 9 +move 1 from 9 to 7 +move 1 from 7 to 1 +move 5 from 8 to 4 +move 4 from 1 to 9 +move 6 from 9 to 4 +move 5 from 1 to 5 +move 5 from 2 to 3 +move 4 from 8 to 2 +move 5 from 1 to 4 +move 4 from 5 to 9 +move 9 from 4 to 9 +move 10 from 9 to 8 +move 1 from 9 to 1 +move 2 from 2 to 8 +move 4 from 3 to 8 +move 1 from 2 to 3 +move 2 from 9 to 2 +move 1 from 2 to 6 +move 4 from 4 to 3 +move 3 from 5 to 1 +move 12 from 1 to 4 +move 1 from 5 to 3 +move 1 from 5 to 3 +move 5 from 8 to 5 +move 7 from 8 to 5 +move 8 from 3 to 4 +move 1 from 5 to 1 +move 1 from 6 to 7 +move 2 from 1 to 6 +move 8 from 5 to 9 +move 2 from 5 to 1 +move 9 from 1 to 4 +move 20 from 4 to 2 +move 1 from 5 to 2 +move 4 from 4 to 2 +move 5 from 9 to 2 +move 2 from 8 to 9 +move 23 from 2 to 4 +move 2 from 2 to 5 +move 5 from 1 to 2 +move 28 from 4 to 3 +move 2 from 8 to 1 +move 2 from 5 to 7 +move 1 from 6 to 9 +move 1 from 4 to 8 +move 1 from 8 to 9 +move 1 from 4 to 6 +move 2 from 7 to 2 +move 13 from 3 to 4 +move 5 from 9 to 7 +move 1 from 9 to 6 +move 14 from 2 to 6 +move 1 from 4 to 1 +move 10 from 3 to 2 +move 1 from 6 to 9 +move 2 from 3 to 2 +move 3 from 1 to 9 +move 1 from 3 to 5 +move 3 from 9 to 3 +move 6 from 7 to 4 +move 1 from 9 to 4 +move 1 from 9 to 2 +move 1 from 5 to 3 +move 5 from 3 to 1 +move 17 from 4 to 7 +move 2 from 2 to 8 +move 1 from 3 to 9 +move 1 from 8 to 2 +move 1 from 9 to 6 +move 4 from 6 to 2 +move 10 from 6 to 5 +move 4 from 1 to 5 +move 15 from 2 to 9 +move 1 from 8 to 6 +move 1 from 2 to 8 +move 6 from 9 to 2 +move 3 from 4 to 8 +move 11 from 7 to 1 +move 6 from 9 to 6 +move 1 from 6 to 2 +move 3 from 9 to 3 +move 6 from 2 to 7 +move 6 from 7 to 8 +move 7 from 1 to 9 +move 4 from 1 to 6 +move 2 from 1 to 2 +move 4 from 6 to 7 +move 1 from 2 to 9 +move 1 from 2 to 3 +move 1 from 2 to 1 +move 6 from 8 to 4 +move 2 from 6 to 7 +move 13 from 5 to 9 +move 1 from 5 to 4 +move 3 from 4 to 7 +move 1 from 1 to 7 +move 14 from 9 to 2 +move 2 from 9 to 3 +move 3 from 8 to 5 +move 4 from 3 to 4 +move 8 from 4 to 1 +move 7 from 1 to 9 +move 5 from 6 to 9 +move 4 from 9 to 2 +move 1 from 1 to 9 +move 17 from 2 to 4 +move 1 from 6 to 3 +move 4 from 7 to 5 +move 5 from 7 to 5 +move 1 from 6 to 4 +move 1 from 8 to 3 +move 5 from 7 to 1 +move 2 from 7 to 6 +move 2 from 3 to 6 +move 1 from 2 to 9 +move 7 from 9 to 6 +move 2 from 3 to 7 +move 8 from 6 to 4 +move 3 from 9 to 2 +move 1 from 6 to 4 +move 26 from 4 to 8 +move 2 from 7 to 8 +move 5 from 5 to 9 +move 2 from 6 to 7 +move 4 from 9 to 1 +move 2 from 7 to 5 +move 14 from 8 to 6 +move 3 from 2 to 8 +move 3 from 6 to 8 +move 3 from 6 to 1 +move 10 from 8 to 4 +move 5 from 9 to 4 +move 3 from 8 to 5 +move 1 from 8 to 2 +move 12 from 4 to 8 +move 1 from 9 to 3 +move 6 from 6 to 4 +move 6 from 8 to 2 +move 1 from 3 to 8 +move 1 from 8 to 4 +move 10 from 1 to 9 +move 2 from 1 to 3 +move 7 from 4 to 9 +move 1 from 2 to 1 +move 11 from 8 to 9 +move 1 from 3 to 9 +move 2 from 2 to 7 +move 1 from 3 to 6 +move 2 from 7 to 9 +move 2 from 4 to 6 +move 4 from 6 to 4 +move 2 from 2 to 8 +move 2 from 8 to 4 +move 1 from 1 to 7 +move 2 from 2 to 8 +move 9 from 5 to 2 +move 3 from 5 to 9 +move 1 from 8 to 3 +move 30 from 9 to 7 +move 1 from 6 to 2 +move 7 from 4 to 8 +move 13 from 7 to 2 +move 8 from 7 to 4 +move 2 from 4 to 8 +move 8 from 8 to 1 +move 1 from 8 to 3 +move 2 from 8 to 9 +move 1 from 3 to 7 +move 5 from 7 to 6 +move 1 from 3 to 1 +move 7 from 4 to 8 +move 20 from 2 to 6 +move 2 from 2 to 7 +move 1 from 9 to 5 +move 4 from 7 to 6 +move 3 from 7 to 8 +move 1 from 7 to 2 +move 7 from 8 to 6 +move 3 from 6 to 7 +move 4 from 9 to 1 +move 1 from 2 to 6 +move 1 from 9 to 7 +move 1 from 2 to 8 +move 1 from 7 to 6 +move 3 from 6 to 3 +move 4 from 8 to 1 +move 8 from 6 to 4 +move 3 from 7 to 2 +move 1 from 3 to 2 +move 1 from 4 to 5 +move 2 from 3 to 5 +move 1 from 4 to 6 +move 4 from 1 to 5 +move 4 from 2 to 9 +move 2 from 1 to 6 +move 4 from 9 to 2 +move 3 from 2 to 8 +move 2 from 8 to 4 +move 13 from 6 to 1 +move 4 from 5 to 2 +move 14 from 6 to 3 +move 1 from 2 to 7 +move 2 from 2 to 4 +move 1 from 8 to 6 +move 1 from 6 to 3 +move 1 from 7 to 4 +move 1 from 2 to 3 +move 1 from 2 to 6 +move 11 from 4 to 6 +move 2 from 5 to 4 +move 1 from 5 to 6 +move 12 from 3 to 6 +move 1 from 3 to 7 +move 1 from 5 to 7 +move 3 from 3 to 6 +move 2 from 7 to 5 +move 2 from 5 to 2 +move 8 from 6 to 7 +move 24 from 1 to 3 +move 1 from 4 to 6 +move 10 from 3 to 1 +move 6 from 1 to 8 +move 1 from 6 to 3 +move 1 from 4 to 2 +move 1 from 3 to 1 +move 2 from 2 to 1 +move 1 from 7 to 6 +move 2 from 7 to 5 +move 4 from 3 to 7 +move 1 from 2 to 3 +move 6 from 1 to 6 +move 3 from 7 to 5 +move 4 from 7 to 8 +move 1 from 1 to 2 +move 1 from 2 to 7 +move 8 from 3 to 4 +move 3 from 4 to 7 +move 6 from 8 to 6 +move 2 from 3 to 2 +move 1 from 3 to 9 +move 5 from 5 to 1 +move 2 from 8 to 2 +move 1 from 9 to 2 +move 4 from 1 to 3 +move 3 from 2 to 9 +move 1 from 1 to 2 +move 2 from 9 to 7 +move 2 from 2 to 9 +move 8 from 7 to 5 +move 33 from 6 to 5 +move 20 from 5 to 9 +move 21 from 5 to 7 +move 17 from 7 to 6 +move 10 from 6 to 9 +move 5 from 4 to 7 +move 2 from 3 to 9 +move 1 from 2 to 3 +move 2 from 7 to 3 +move 3 from 9 to 5 +move 23 from 9 to 7 +move 8 from 9 to 6 +move 1 from 9 to 1 +move 1 from 5 to 3 +move 1 from 8 to 9 +move 5 from 6 to 8 +move 1 from 9 to 6 +move 18 from 7 to 2 +move 6 from 7 to 4 +move 6 from 4 to 8 +move 5 from 7 to 4 +move 6 from 6 to 3 +move 1 from 4 to 2 +move 10 from 2 to 1 +move 1 from 2 to 4 +move 7 from 1 to 6 +move 1 from 7 to 1 +move 11 from 6 to 2 +move 1 from 6 to 8 +move 12 from 3 to 1 +move 8 from 1 to 8 +move 2 from 5 to 2 +move 12 from 8 to 6 +move 15 from 2 to 4 +move 7 from 4 to 5 +move 4 from 5 to 9 +move 4 from 9 to 4 +move 5 from 4 to 6 +move 2 from 5 to 2 +move 1 from 2 to 5 +move 2 from 5 to 4 +move 2 from 1 to 3 +move 4 from 1 to 5 +move 2 from 8 to 4 +move 5 from 2 to 9 +move 17 from 6 to 8 +move 1 from 3 to 2 +move 2 from 5 to 4 +move 1 from 3 to 8 +move 1 from 1 to 6 +move 2 from 5 to 6 +move 3 from 9 to 5 +move 1 from 5 to 1 +move 3 from 1 to 8 +move 26 from 8 to 4 +move 1 from 5 to 3 +move 3 from 2 to 7 +move 1 from 5 to 7 +move 21 from 4 to 9 +move 19 from 4 to 5 +move 3 from 4 to 3 +move 2 from 7 to 5 +move 1 from 8 to 2 +move 1 from 6 to 2 +move 1 from 8 to 9 +move 1 from 6 to 7 +move 1 from 2 to 4 +move 1 from 4 to 7 +move 1 from 2 to 7 +move 1 from 7 to 1 +move 1 from 1 to 6 +move 1 from 3 to 5 +move 2 from 6 to 3 +move 13 from 5 to 8 +move 1 from 4 to 2 +move 3 from 5 to 4 +move 5 from 5 to 4 +move 5 from 8 to 9 +move 9 from 9 to 3 +move 2 from 7 to 1 +move 6 from 4 to 2 +move 8 from 9 to 4 +move 1 from 2 to 7 +move 12 from 9 to 8 +move 1 from 4 to 2 +move 3 from 7 to 3 +move 11 from 8 to 5 +move 5 from 8 to 6 +move 3 from 6 to 5 +move 2 from 4 to 1 +move 13 from 5 to 3 +move 1 from 1 to 7 +move 2 from 1 to 8 +move 3 from 4 to 9 +move 1 from 1 to 7 +move 1 from 2 to 4 +move 2 from 7 to 3 +move 1 from 5 to 3 +move 4 from 4 to 2 +move 1 from 4 to 9 +move 30 from 3 to 2 +move 1 from 9 to 7 +move 6 from 8 to 6 +move 1 from 7 to 6 +move 1 from 5 to 1 +move 1 from 3 to 5 +move 30 from 2 to 3 +move 1 from 1 to 9 +move 2 from 9 to 2 +move 9 from 6 to 9 +move 2 from 2 to 9 +move 1 from 5 to 1 +move 5 from 9 to 7 +move 8 from 2 to 5 +move 1 from 1 to 9 +move 3 from 9 to 1 +move 5 from 3 to 6 +move 8 from 5 to 9 +move 13 from 3 to 9 +move 3 from 1 to 7 +move 5 from 7 to 9 +move 17 from 9 to 6 +move 1 from 7 to 6 +move 6 from 3 to 9 +move 1 from 2 to 1 +move 2 from 7 to 1 +move 1 from 2 to 5 +move 21 from 9 to 2 +move 4 from 3 to 6 +move 6 from 6 to 5 +move 7 from 5 to 9 +move 2 from 3 to 8 +move 3 from 1 to 3 +move 4 from 6 to 5 +move 1 from 8 to 1 +move 1 from 8 to 2 +move 4 from 5 to 2 +move 4 from 9 to 1 +move 4 from 3 to 5 +move 2 from 1 to 7 +move 1 from 7 to 4 +move 3 from 9 to 5 +move 25 from 2 to 9 +move 18 from 9 to 1 +move 1 from 4 to 5 +move 1 from 3 to 8 +move 4 from 5 to 6 +move 2 from 9 to 3 +move 17 from 1 to 5 +move 1 from 2 to 7 +move 2 from 3 to 5 +move 3 from 1 to 8 +move 5 from 9 to 2 +move 4 from 8 to 9 +move 12 from 5 to 2 +move 1 from 1 to 8 +move 3 from 9 to 5 +move 1 from 8 to 2 +move 2 from 7 to 2 +move 1 from 9 to 5 +move 9 from 5 to 2 +move 6 from 6 to 2 +move 15 from 6 to 2 +move 5 from 5 to 9 +move 1 from 5 to 9 +move 3 from 9 to 2 +move 3 from 9 to 1 +move 1 from 1 to 9 +move 1 from 9 to 1 +move 19 from 2 to 8 +move 2 from 1 to 9 +move 33 from 2 to 6 +move 4 from 6 to 4 +move 1 from 2 to 6 +move 1 from 9 to 8 +move 3 from 4 to 8 +move 18 from 8 to 3 +move 1 from 4 to 9 +move 10 from 3 to 9 +move 1 from 1 to 4 +move 24 from 6 to 3 +move 1 from 4 to 3 +move 2 from 8 to 7 +move 8 from 9 to 3 +move 5 from 6 to 7 +move 35 from 3 to 2 +move 7 from 7 to 1 +move 3 from 1 to 3 +move 33 from 2 to 6 +move 6 from 3 to 7 +move 5 from 7 to 3 +move 1 from 1 to 4 +move 1 from 7 to 8 +move 1 from 4 to 8 +move 1 from 3 to 2 +move 30 from 6 to 5 +move 2 from 1 to 6 +move 5 from 8 to 1 +move 1 from 9 to 2 +move 2 from 6 to 4 +move 4 from 1 to 7 +move 21 from 5 to 8 diff --git a/day05/examples/test.txt b/day05/examples/test.txt new file mode 100644 index 0000000..84933bb --- /dev/null +++ b/day05/examples/test.txt @@ -0,0 +1,9 @@ + [D] +[N] [C] +[Z] [M] [P] + 1 2 3 + +move 1 from 2 to 1 +move 3 from 1 to 3 +move 2 from 2 to 1 +move 1 from 1 to 2 diff --git a/day06/app/Main.hs b/day06/app/Main.hs new file mode 100644 index 0000000..68f1492 --- /dev/null +++ b/day06/app/Main.hs @@ -0,0 +1,154 @@ +{- +--- Day 6: Tuning Trouble --- + +The preparations are finally complete; you and the Elves leave camp on foot and begin to make +your way toward the star fruit grove. + +As you move through the dense undergrowth, one of the Elves gives you a handheld device. He +says that it has many fancy features, but the most important one to set up right now is the +communication system. + +However, because he's heard you have significant experience dealing with signal-based systems, +he convinced the other Elves that it would be okay to give you their one malfunctioning device +- surely you'll have no problem fixing it. + +As if inspired by comedic timing, the device emits a few colorful sparks. + +To be able to communicate with the Elves, the device needs to lock on to their signal. The +signal is a series of seemingly-random characters that the device receives one at a time. + +To fix the communication system, you need to add a subroutine to the device that detects a +start-of-packet marker in the datastream. In the protocol being used by the Elves, the start +of a packet is indicated by a sequence of four characters that are all different. + +The device will send your subroutine a datastream buffer (your puzzle input); your subroutine +needs to identify the first position where the four most recently received characters were all +different. Specifically, it needs to report the number of characters from the beginning of the +buffer to the end of the first such four-character marker. + +For example, suppose you receive the following datastream buffer: + +``` +mjqjpqmgbljsphdztnvjfqwrcgsmlb +``` + +After the first three characters (mjq) have been received, there haven't been enough characters +received yet to find the marker. The first time a marker could occur is after the fourth +character is received, making the most recent four characters mjqj. Because j is repeated, this +isn't a marker. + +The first time a marker appears is after the seventh character arrives. Once it does, the last +four characters received are jpqm, which are all different. In this case, your subroutine +should report the value 7, because the first start-of-packet marker is complete after 7 +characters have been processed. + +Here are a few more examples: + + bvwbjplbgvbhsrlpgdmjqwftvncz: first marker after character 5 + nppdvjthqldpwncqszvftbrmjlhg: first marker after character 6 + nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg: first marker after character 10 + zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw: first marker after character 11 + +How many characters need to be processed before the first start-of-packet marker is detected? + +--- Part Two --- + +Your device's communication system is correctly detecting packets, but still isn't working. It +looks like it also needs to look for messages. + +A start-of-message marker is just like a start-of-packet marker, except it consists of 14 +distinct characters rather than 4. + +Here are the first positions of start-of-message markers for all of the above examples: + + mjqjpqmgbljsphdztnvjfqwrcgsmlb: first marker after character 19 + bvwbjplbgvbhsrlpgdmjqwftvncz: first marker after character 23 + nppdvjthqldpwncqszvftbrmjlhg: first marker after character 23 + nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg: first marker after character 29 + zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw: first marker after character 26 + +How many characters need to be processed before the first start-of-message marker is detected? +-} +{-# LANGUAGE DerivingStrategies #-} +{-# OPTIONS_GHC -Wno-unrecognised-pragmas #-} +{-# HLINT ignore "Use ordNub" #-} +{-# OPTIONS_GHC -Wno-unsafe #-} + +module Main (main) where + +import Data.ByteString.Lazy (ByteString) +import Data.Discrimination (Grouping, nub) +import Data.List (findIndex, length) +import Options.Applicative (Parser, ParserInfo, argument, execParser, fullDesc, help, helper, info, metavar, str) +import Relude hiding (ByteString, elem, empty, filter, fromList, length, null, optional, readFile, splitAt) +import Text.Parsec (ParseError, parse, ()) +import Text.Parsec.ByteString.Lazy (GenParser) +import Text.Parsec.Char (anyChar, string) +import Text.Parsec.Combinator (eof, many1) +import Text.Parsec.Prim (parsecMap, try) + +type Opts :: Type +newtype Opts = Opts {_filename :: Text} deriving stock (Show) + +parseInput :: FilePath -> ByteString -> Either ParseError String +parseInput = parse $ many1 anyChar <* (eol <|> eof) + where + eol :: GenParser t st () + eol = + parsecMap + (const ()) + ( try (string "\n\r") + <|> try (string "\r\n") + <|> string "\n" + <|> string "\r" + "end of line" + ) + +window :: Int -> [a] -> [[a]] +window n xs = + if n > length xs + then [] + else take n xs : window n (drop 1 xs) + +allunique :: Grouping a => [a] -> Bool +allunique xs = nub xs == xs + +run :: Int -> String -> Maybe Int +run nchars = findIndex allunique . window nchars + +runPart1 :: String -> Int +runPart1 xs = case run nchars xs of + Nothing -> error "Failure" + Just res -> nchars + res + where + nchars :: Int + nchars = 4 + +runPart2 :: String -> Int +runPart2 xs = case run nchars xs of + Nothing -> error "Failure" + Just res -> nchars + res + where + nchars :: Int + nchars = 14 + +main :: IO () +main = do + fileName <- toString . _filename <$> execParser opts + rawInput <- readFileLBS fileName + case parseInput fileName rawInput of + Left e -> do + putTextLn "Error parsing input:" + print e + Right r -> do + print $ runPart1 r + print $ runPart2 r + where + opts :: ParserInfo Opts + opts = info (helper <*> options) fullDesc + + options :: Parser Opts + options = Opts <$> filename + + filename :: Parser Text + filename = argument str $ metavar "filename" <> help "Input file" diff --git a/day06/day06.cabal b/day06/day06.cabal new file mode 100644 index 0000000..a189f1f --- /dev/null +++ b/day06/day06.cabal @@ -0,0 +1,35 @@ +cabal-version: 2.4 +name: day06 +version: 0.1.0.0 +synopsis: + +-- A URL where users can report bugs. +-- bug-reports: +license: +author: Shivesh Mandalia +maintainer: mail@shivesh.org + +executable day06 + main-is: Main.hs + + -- Modules included in this executable, other than Main. + -- other-modules: + + -- LANGUAGE extensions used by modules in this package. + default-extensions: + NoImplicitPrelude + OverloadedStrings + StandaloneKindSignatures + + build-depends: + , base ^>=4.16.4.0 + , discrimination >=0.5 + , optparse-applicative >=0.17.0.0 + , parsec >=3.1.16.1 + , relude ^>=1.1.0.0 + + hs-source-dirs: app + default-language: Haskell2010 + ghc-options: + -Weverything -Wno-unused-packages -Wno-missing-safe-haskell-mode + -Wno-safe -Wno-missing-import-lists diff --git a/day06/examples/input.txt b/day06/examples/input.txt new file mode 100644 index 0000000..636557c --- /dev/null +++ b/day06/examples/input.txt @@ -0,0 +1 @@ +gzbzwzjwwrfftfrrbvvcbcvcffpssvhhzfzbfzzrbrtrcttnthnhsnhsnnclcpctpprwwgppppchhvvctvtsvswwcdcrrdzdhzdzvddvfvfjjlldvvfllfhlfhlhghnhghrgrsggvbbhdhffzggmttjqtjjgljjwtjwjggldlzzrfrpppjsjggqrrdbbgwgtwwwtqwtqqvccjnnhrhqqsnssjbssmjjbzjjqnqnlnjncjjzzqddfqqqnqvnqncqqmsshqqccssvpvllbbfvfmmmgzgdggtjgjtjbttngtnnhhfrfddmtmtftcftthvttwzwrzrbrgrbrqbqccmmtvtqvtqqzmzwmzzzsvzvhhhqlhqlqplpggvmvwmmshhnshsjszzljlnlrnllgddqllpmllsgswwqnqlnlqqlmqqvrqvrqrppvrrqwqhqllgjgcggsllqgllghlghhbvhhcvvbddvcvwwwzdzzfjjvcczbbwccjvccmvmfvfgfmfttwrttpmtmsszccjggcssmqsmsgszzfpphghvgvvcddtltwlwnnrbbfdbbtssrvvmwwjfflmlblwlrlmlwwhrhnhqnnvdvllzblzzndzdlzzhpprbrprnrzrjjlnlnrrjddgrrwrttcstsgshszzvgvfvpfpqfpfbpbfbwbmmzvvnnqvvqppzspzpzplldqlqsqlldmlmgmcmwmsmfsfzfdzzbpzzbbcwbbtppphlhshchjjszztctpprqppszzchcqczczddscsrstsntstjsjqjjfggvccgbggqhghrhppdldnlndnpddllgplgppnlpnnmwwglghhftfrtrqtqsszrssfjjzhzfhfssflfslsmmgrrcdrdnrdnnqznndrrbtrrmhrhbhsbsgsnslsqlqnncpccplpldpldppshsdssqdsqdsqdsdsdfsddchczhczcszcscffzhfzffpbbgttdhthnhnjnwnnwrrmwmlljzlzlzdzrrcvcbbsfstfsfnfqftqffgjfjzfjfsjswswccsvcvlccshhjpjcccnfnqqmsqmmrwmwjwswgsgjsjttmjmjttpqtqwttgmgfmmnbnrnpnwppgspggwnwqnqpqmmbmmnwnllbwwdqqzsqqtgttnrtrllcwcchpchcbhbpbnpbpsptpvtvzvrzzslljddjzjjmqmmdpmddcdzzrdrqddtctppwzzwrzrvzrvrzzjtztqqsmmcncllhmlmpmhgsrtrzjhjbtfvhmzpssfbjwcdshthnmmqmfhlhwcbbllwzbwfgfvzjcqblchzqqqgcgmpnbnnblhbcpgmvsbvtcmhsghldlhqlghgtpdvjflmjsmppdsvrjlwvhmwsmfvvdnzpmtfqjqpjdctnnrlfjfvdtmvdmhsczlfsqwfrqtlqwnzdzrcdzmhvrgwnjjtqjrqljhgcffglvhnsdssqdpfrfhtjwlqzvfjmpjnqhsjvndtstqjsqgcmgqdjvfqnlmtjlvcblndprmffrgqdnnncnlfflclgqbjbmsdqsjrmzpwtbqqqqsqmgthhjfqwzvcbqwlvdbffhcvncpldmchnptbnlbhmzrrjhzvzdrvtlhsnfnfdnvhlrlrmdcpnmvdwswctcqldszlvftqtwldrhmfjmfvcgjcdjsbjqjwdtslblwhqfvgrfcpnhszqqsfwbwcmvfvccvztdmcjqfjvdvmbdtcjvtwqpwsqjtdvpvvvsdrrvngmjztgjtnpdbmtlrbrjlwsdnthgzgpssgbzzrqvgblqhrtfbflnphvhpzmdfrwqvjjvcpsmdrqwdbzlpnqpmglgqzfhctrzdpzdthqgjtvpwcrlsmqnjwgzlnqbthvfswhjtrrsrswhbmnddgzmznvppbnmtjpzpdpmpzpmsgfstzldgmrtgplwwsbztphtcvdfgsqzqwrmlqpnhvpcqpfjpbrthrtwgqlfnrqcrpvhssjmhfgpnzzvlrlcbnpmddhtdvvfrrvprqrwbhfgvvltgrhrpwsdgvrlgthbztcgcfggtcfzqtlcdhpmcvpgcszslhpfrttnrdrqpqlgdfwtccmbhfrnlbhhmrtrjmzstbqhmtphzcpcllzsnghfvlwvzzvlqrjmfsvhrnjnvldgnbqvpjsmmphhrmhqrtcncmjwbdlqtrvmhgjrjsrddcpqnjhfmczfgwzspnrjfwvfdpdlcfpvctfrlspdwwlnpbvbglzsmgfsmrshsqgcvlfrvjssrglbwvvvgpvtqshbtqmzbnglflhhldtfzqssptrbnnzdqwqtstpftdqgmmhfjdlfwtmcmtmcgcvtfhzvsbllgbchvlhrgnvvbsnrwqrlvdqlcwwlgbjrvrzgcvljqzvdngtbhpnppjrzpmbwztzvnvrbfccfgvnqvrcmpdblngcvlwjwzpbbwmnslsdjmbrwbvnjsgcmsfvzvnwbzrrlzvgdnzcqqgggvmcwczjqnrddnzhlndgzjbvtbtjqdnlvlflqnfvjdmfstpdfqsgjdslgtpgdnvvpmfwvlqbmbgdrqjhdfhlmsdtfwpscsvdzmswszjfwqtsjqpfnjjlnsspvlgzwwtvwgdzfjjljfwbvfbvpglcqcdbdpshwcqzswbwhftbfqblzpqfmqpvzdjsrcqtvjntnhmlhmzllffcjsdnwpfzdglvlrhrljbrhjhgdnfcqcrccwrbbhrvqwrzlwjrrwzsfcwsvbqsjgtgpzqwlczljrtdhtzcgsfgqssdbjjmttdtzhrqtbqjtqfwmcpdftrfjmznpscsqmtfcdpcdjwcqjvmhngcqnmtmwfttcvpwgcnhhgnnbgjdvztzhczvqljjqwcmwcbvmqqjsfnmhtbtsvsnsfwfzgdvlctrgdvbjqpgfrrlsnppmvhfbbclprlvcssnvtsgftmlpqrpjzrrphrzltbtgfwjqqvbgqjdpdgqvzppfzcbhdbbjttcdzclsphtlzfvnfqgpmqvpzrqgpdnbmsrqgsnfdwpvndzmsllgmnrlhnnzldwshtrrsrsmdncwrcjnmcjlwbbfpzcwzvldtgvbcvhnbhgjgwjcvslrfcwbqlrqldvpcgnbwbzzncncftrgbrwchfrrtnpqsjbcpzvplnbqdgtvnnrcwwfvbdzdrsfspvtbhflhsbqmlsjvfmpvjbfvcrdmgrfqsmqgfrntfqnlqbvmsqtpncjrstspbqvfmddmhwsssdcddshmwdlscttmdzljtpwhzhzhwsdnmgjstfmlnqqvzzdqpqsjdsllswmqcjtnthwqnhbscrjdstljqgncjvjvlpfrtscrzrqghrdvdnbtnpshpldcchljzrzqjlwwscnphvrwlvzttcdjdrddgmvqpvdmttdqhwpfmslzvnrwlrrdttbhctgpgzjrmdwjbcmsprwggvmdmmltldgpbfnppnrpwcnpgtblccdvbsnfvgzmjppftvndmdslfshjvndfvvzjjlzhgfmhcggttrcrbrlwrqgjpchvhnjwqnbsnmftwszhzftglrfdvvnbcbzsslgmdchtrrrqqzhllrfhwfwbbdgfpdfwssmzcfcnzmrhfdddtdhfqmctsglqbwhwpnbdzbsfbbvvthrrgjvztjjwgjcgjntrddmmdldtmvjnwjbcqwfwvfhsrpchznhlqpcttqjffbrpbftftdjzlrqchmzrfgjrqlndfwfrghtsfsblcvtjmjrbfrwdgsgzmmjpdlbwzfscfsfcdqwdwnjwjbvvbptmfrqltmnlpbtrqspwdfmhnncqgtrtmbzhfmwrbcqhmmpmvprvwrjplspcmmspldmbgpbtmqjtrfcpfhcnpjbnlhjpzflstjqfqvzcnfgvrmtplndchffzrtfrqdpdnzrspddwmpzlfchrzzfcfvmbvfnlfwtfbvnffdqhljbvwwdtmszgrjtzwqdbgvvfphcnsdgvlmslqngfmsbrztrnpjprghmjffscbnfqwrvjjjtfzrmjtzbwdsmzgmbtjzvddhngmzvflwftblbzfd diff --git a/day06/examples/test0.txt b/day06/examples/test0.txt new file mode 100644 index 0000000..7980a82 --- /dev/null +++ b/day06/examples/test0.txt @@ -0,0 +1 @@ +mjqjpqmgbljsphdztnvjfqwrcgsmlb diff --git a/day06/examples/test1.txt b/day06/examples/test1.txt new file mode 100644 index 0000000..19fe247 --- /dev/null +++ b/day06/examples/test1.txt @@ -0,0 +1 @@ +bvwbjplbgvbhsrlpgdmjqwftvncz diff --git a/day06/examples/test2.txt b/day06/examples/test2.txt new file mode 100644 index 0000000..0f12ee2 --- /dev/null +++ b/day06/examples/test2.txt @@ -0,0 +1 @@ +nppdvjthqldpwncqszvftbrmjlhg diff --git a/day06/examples/test3.txt b/day06/examples/test3.txt new file mode 100644 index 0000000..38510e7 --- /dev/null +++ b/day06/examples/test3.txt @@ -0,0 +1 @@ +nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg diff --git a/day06/examples/test4.txt b/day06/examples/test4.txt new file mode 100644 index 0000000..e1d0a43 --- /dev/null +++ b/day06/examples/test4.txt @@ -0,0 +1 @@ +zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw diff --git a/day07/app/Main.hs b/day07/app/Main.hs new file mode 100644 index 0000000..413fcca --- /dev/null +++ b/day07/app/Main.hs @@ -0,0 +1,259 @@ +{- +--- Day 7: No Space Left On Device --- +You can hear birds chirping and raindrops hitting leaves as the expedition proceeds. +Occasionally, you can even hear much louder sounds in the distance; how big do the +animals get out here, anyway? +The device the Elves gave you has problems with more than just its communication system. You +try to run a system update: +``` +\$ system-update --please --pretty-please-with-sugar-on-top +Error: No space left on device +``` +Perhaps you can delete some files to make space for the update? +You browse around the filesystem to assess the situation and save the resulting terminal output +(your puzzle input). For example: +``` +\$ cd / +\$ ls +dir a +14848514 b.txt +8504156 c.dat +dir d +\$ cd a +\$ ls +dir e +29116 f +2557 g +62596 h.lst +\$ cd e +\$ ls +584 i +\$ cd .. +\$ cd .. +\$ cd d +\$ ls +4060174 j +8033020 d.log +5626152 d.ext +7214296 k +``` +The filesystem consists of a tree of files (plain data) and directories (which can contain +other directories or files). The outermost directory is called /. You can navigate around the +filesystem, moving into or out of directories and listing the contents of the directory you're +currently in. +Within the terminal output, lines that begin with $ are commands you executed, very much like +some modern computers: + cd means change directory. This changes which directory is the current directory, but the + specific result depends on the argument: + cd x moves in one level: it looks in the current directory for the directory named x + and makes it the current directory. + cd .. moves out one level: it finds the directory that contains the current directory, + then makes that directory the current directory. + cd / switches the current directory to the outermost directory, /. + ls means list. It prints out all of the files and directories immediately contained by the + current directory: + 123 abc means that the current directory contains a file named abc with size 123. + dir xyz means that the current directory contains a directory named xyz. +Given the commands and output in the example above, you can determine that the filesystem looks +visually like this: +``` +- / (dir) + - a (dir) + - e (dir) + - i (file, size=584) + - f (file, size=29116) + - g (file, size=2557) + - h.lst (file, size=62596) + - b.txt (file, size=14848514) + - c.dat (file, size=8504156) + - d (dir) + - j (file, size=4060174) + - d.log (file, size=8033020) + - d.ext (file, size=5626152) + - k (file, size=7214296) +``` +Here, there are four directories: / (the outermost directory), a and d (which are in /), and e +(which is in a). These directories also contain files of various sizes. +Since the disk is full, your first step should probably be to find directories that are good +candidates for deletion. To do this, you need to determine the total size of each directory. +The total size of a directory is the sum of the sizes of the files it contains, directly or +indirectly. (Directories themselves do not count as having any intrinsic size.) +The total sizes of the directories above can be found as follows: + The total size of directory e is 584 because it contains a single file i of size 584 and no + other directories. + The directory a has total size 94853 because it contains files f (size 29116), g (size + 2557), and h.lst (size 62596), plus file i indirectly (a contains e which contains i). + Directory d has total size 24933642. + As the outermost directory, / contains every file. Its total size is 48381165, the sum of + the size of every file. +To begin, find all of the directories with a total size of at most 100000, then calculate the +sum of their total sizes. In the example above, these directories are a and e; the sum of +their total sizes is 95437 (94853 + 584). (As in this example, this process can count files +more than once!) +Find all of the directories with a total size of at most 100000. What is the sum of the total +sizes of those directories? + +--- Part Two --- + +Now, you're ready to choose a directory to delete. + +The total disk space available to the filesystem is 70000000. To run the update, you need +unused space of at least 30000000. You need to find a directory you can delete that will free +up enough space to run the update. + +In the example above, the total size of the outermost directory (and thus the total amount of +used space) is 48381165; this means that the size of the unused space must currently be +21618835, which isn't quite the 30000000 required by the update. Therefore, the update still +requires a directory with total size of at least 8381165 to be deleted before it can run. + +To achieve this, you have the following options: + + Delete directory e, which would increase unused space by 584. + Delete directory a, which would increase unused space by 94853. + Delete directory d, which would increase unused space by 24933642. + Delete directory /, which would increase unused space by 48381165. + +Directories e and a are both too small; deleting them would not free up enough space. However, +directories d and / are both big enough! Between these, choose the smallest: d, increasing +unused space by 24933642. + +Find the smallest directory that, if deleted, would free up enough space on the filesystem to +run the update. What is the total size of that directory? +-} +{-# LANGUAGE DerivingStrategies #-} + +module Main (main) where + +import Data.ByteString.Lazy (ByteString) +import Data.Char (digitToInt) +import Data.Foldable +import Data.List (filter) +import Options.Applicative (Parser, ParserInfo, argument, execParser, fullDesc, help, helper, info, metavar, str) +import Relude hiding (ByteString, elem, empty, filter, fromList, length, null, optional, readFile, splitAt, sum) +import Text.Parsec (ParseError, parse, ()) +import Text.Parsec.ByteString.Lazy (GenParser) +import Text.Parsec.Char (anyChar, char, digit, string) +import Text.Parsec.Combinator (eof, many1, manyTill) +import Text.Parsec.Prim (parsecMap, try) + +type Opts :: Type +newtype Opts = Opts {_filename :: Text} deriving stock (Show) + +type FileData :: Type +data FileData = FileData {_name :: Text, _size :: Int} deriving stock (Show) + +type ParseDirOrFile :: Type +data ParseDirOrFile = ParseDir | ParseFile FileData + +type Queries :: Type +data Queries = ChangeDir Text | List [FileData] deriving stock (Show) + +type SystemEntry :: Type -> Type +data SystemEntry a = File a | Directory Text [SystemEntry a] deriving stock (Show) + +root :: SystemEntry FileData +root = Directory "/" [] + +foldrEntry :: Monoid b => (a -> b -> b) -> b -> SystemEntry a -> b +foldrEntry f b (File fd) = f fd b +foldrEntry f b (Directory _ xs) = mconcat $ fmap (foldrEntry f b) xs + +instance Foldable SystemEntry where + foldMap fam = foldrEntry (mappend . fam) mempty + +parseInput :: FilePath -> ByteString -> Either ParseError [Queries] +parseInput = parse $ queries <* (eol <|> eof) + where + queries :: GenParser t st [Queries] + queries = many1 (cd <|> ls) + + cd :: GenParser t st Queries + cd = ChangeDir <$> (try (string "$ cd ") *> (toText <$> manyTill anyChar (eol <|> eof))) + + ls :: GenParser t st Queries + ls = List . filterDir <$> ((try (string "$ ls") *> (eol <|> eof)) *> many1 (dir <|> file)) + + dir :: GenParser t st ParseDirOrFile + dir = ParseDir <$ try (string "dir ") <* manyTill anyChar (eol <|> eof) + + file :: GenParser t st ParseDirOrFile + file = ParseFile <$> (flip FileData <$> (int <* char ' ') <*> (toText <$> manyTill anyChar (eol <|> eof))) + + filterDir :: [ParseDirOrFile] -> [FileData] + filterDir [] = [] + filterDir (ParseDir : xs) = filterDir xs + filterDir ((ParseFile fd) : xs) = fd : filterDir xs + + int :: GenParser t st Int + int = foldl' (\a i -> a * 10 + digitToInt i) 0 <$> many1 digit + + eol :: GenParser t st () + eol = + parsecMap + (const ()) + ( try (string "\n\r") + <|> try (string "\r\n") + <|> string "\n" + <|> string "\r" + "end of line" + ) + +run :: SystemEntry FileData -> [Queries] -> (SystemEntry FileData, [Queries]) +run se [] = (se, []) +run (Directory n ses) (ChangeDir ".." : qs) = (Directory n ses, qs) +run (Directory n ses) (ChangeDir d : qs) = run (Directory n (ses' : ses)) qs' + where + ses' :: SystemEntry FileData + (ses', qs') = run (Directory d []) qs +run (Directory n ses) (List fd : qs) = run (Directory n (fmap File fd ++ ses)) qs +run _ _ = error "invalid operation" + +getSize :: SystemEntry FileData -> Int +getSize = getSum . foldr ((<>) . Sum . _size) (Sum 0) + +getDirSizes :: SystemEntry FileData -> [Int] +getDirSizes (File _) = [] +getDirSizes (Directory n ses) = + getSize (Directory n ses) : foldl (\a d -> a ++ getDirSizes d) [] ses + +runPart1 :: [Queries] -> Int +runPart1 = sum . filter (<= minSize) . getDirSizes . fst . run root . drop 1 + where + minSize :: Int + minSize = 100000 + +runPart2 :: [Queries] -> Int +runPart2 qs = minimum $ filter (>= requiredSpace - unusedSpace) $ getDirSizes systemEntry + where + systemEntry :: SystemEntry FileData + systemEntry = fst $ run root $ drop 1 qs + + unusedSpace :: Int + unusedSpace = totalSpace - getSize systemEntry + + requiredSpace :: Int + requiredSpace = 30000000 + + totalSpace :: Int + totalSpace = 70000000 + +main :: IO () +main = do + fileName <- toString . _filename <$> execParser opts + rawInput <- readFileLBS fileName + case parseInput fileName rawInput of + Left e -> do + putTextLn "Error parsing input:" + print e + Right r -> do + print $ runPart1 r + print $ runPart2 r + where + opts :: ParserInfo Opts + opts = info (helper <*> options) fullDesc + + options :: Parser Opts + options = Opts <$> filename + + filename :: Parser Text + filename = argument str $ metavar "filename" <> help "Input file" diff --git a/day07/day07.cabal b/day07/day07.cabal new file mode 100644 index 0000000..1053ca2 --- /dev/null +++ b/day07/day07.cabal @@ -0,0 +1,35 @@ +cabal-version: 2.4 +name: day07 +version: 0.1.0.0 +synopsis: + +-- A URL where users can report bugs. +-- bug-reports: +license: +author: Shivesh Mandalia +maintainer: mail@shivesh.org + +executable day07 + main-is: Main.hs + + -- Modules included in this executable, other than Main. + -- other-modules: + + -- LANGUAGE extensions used by modules in this package. + default-extensions: + NoImplicitPrelude + OverloadedStrings + StandaloneKindSignatures + + build-depends: + , base ^>=4.16.4.0 + , discrimination >=0.5 + , optparse-applicative >=0.17.0.0 + , parsec >=3.1.16.1 + , relude ^>=1.1.0.0 + + hs-source-dirs: app + default-language: Haskell2010 + ghc-options: + -Weverything -Wno-unused-packages -Wno-missing-safe-haskell-mode + -Wno-safe -Wno-missing-import-lists diff --git a/day07/examples/input.txt b/day07/examples/input.txt new file mode 100644 index 0000000..1c87c00 --- /dev/null +++ b/day07/examples/input.txt @@ -0,0 +1,979 @@ +$ cd / +$ ls +dir plws +dir pwlbgbz +dir pwtpltr +dir szn +$ cd plws +$ ls +dir ffpzc +dir frcmjzts +92461 nbvnzg +dir phqcg +21621 vqgsglwq +$ cd ffpzc +$ ls +48459 dzdfc.vqq +143107 jql.jzl +208330 mmnvqn.hqb +290122 svjvhflz +218008 wjlmgq +$ cd .. +$ cd frcmjzts +$ ls +dir bsltmjz +dir jfzgrbm +$ cd bsltmjz +$ ls +34237 dzdfc.vqq +58741 mdgdhqgw +$ cd .. +$ cd jfzgrbm +$ ls +132811 fcmpng +103661 lgt.swt +173031 vqgsglwq +29134 wprjfg.zbr +$ cd .. +$ cd .. +$ cd phqcg +$ ls +955 jgfs.zjw +$ cd .. +$ cd .. +$ cd pwlbgbz +$ ls +dir gbg +dir mjzhcwrd +dir njcscpj +dir sphbzn +dir tbgjpphc +55938 tvrfpczc.djm +4840 twd +$ cd gbg +$ ls +287003 fcsjl.bzm +dir wgq +$ cd wgq +$ ls +22963 fcsjl.fcm +$ cd .. +$ cd .. +$ cd mjzhcwrd +$ ls +228632 clfnpmbq.zmb +28276 dzdfc.vqq +2982 tdbg.wgn +$ cd .. +$ cd njcscpj +$ ls +dir dqzgqgv +275186 ffpzc +192491 gjnflc.plq +$ cd dqzgqgv +$ ls +70309 dzdfc.vqq +56139 fcsjl +142095 sgwz.cdz +dir snjntth +dir sphbzn +284618 wjlmgq +$ cd snjntth +$ ls +51918 ffpzc +dir vrfgfds +$ cd vrfgfds +$ ls +155233 jlscz +$ cd .. +$ cd .. +$ cd sphbzn +$ ls +dir qbzwrrw +dir qwpzn +$ cd qbzwrrw +$ ls +278531 fcsjl.tqj +211591 snjntth.gpd +$ cd .. +$ cd qwpzn +$ ls +174183 vqgsglwq +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd sphbzn +$ ls +185471 bsltmjz.fqz +dir bsvh +dir fvzcs +dir ndw +dir nlml +dir pcbt +286260 zhcmrpvt +$ cd bsvh +$ ls +130814 wjlmgq +$ cd .. +$ cd fvzcs +$ ls +dir cgmv +dir ggzwljr +298241 qvzghdpw.lms +dir snjntth +dir sphbzn +$ cd cgmv +$ ls +46843 dzdfc.vqq +dir lmqcbbm +dir rstcqsmd +215261 snjntth +$ cd lmqcbbm +$ ls +229898 bdmbvgp +25529 ffpzc.stm +16871 lnpjzvg.qlj +$ cd .. +$ cd rstcqsmd +$ ls +289038 zrbbbwng.smf +$ cd .. +$ cd .. +$ cd ggzwljr +$ ls +198200 bcthn +$ cd .. +$ cd snjntth +$ ls +191672 fwp.phf +68229 hzs.zpg +dir pggcwb +222426 qbv.bwj +dir snjntth +155354 vmqcm +$ cd pggcwb +$ ls +154272 fqztwvnv.lvv +dir pdjg +62393 vqgsglwq +dir wjhrtg +$ cd pdjg +$ ls +260644 gvhlrcf +209906 wpls.pbd +$ cd .. +$ cd wjhrtg +$ ls +148640 dljf.zrq +172168 dzdfc.vqq +196203 hjdphcfm +247620 sgwz.cdz +$ cd .. +$ cd .. +$ cd snjntth +$ ls +37467 ndlshlmj.cjq +257404 snjntth.nsf +$ cd .. +$ cd .. +$ cd sphbzn +$ ls +64082 bfdv.lwv +dir bsltmjz +58942 dzdfc.vqq +dir snjntth +$ cd bsltmjz +$ ls +dir bsqqdr +266007 fcsjl.gfm +dir ffpzc +dir frsmrd +72122 nthnhzwf +286705 wjlmgq +$ cd bsqqdr +$ ls +117496 wcqt +$ cd .. +$ cd ffpzc +$ ls +280224 mmnvqn.hqb +105346 vrr +$ cd .. +$ cd frsmrd +$ ls +111509 sphbzn.shz +$ cd .. +$ cd .. +$ cd snjntth +$ ls +177491 mplj +9029 pvbz.jwn +92891 snjntth.zrv +203356 vnnnw.gql +134728 vqgsglwq +$ cd .. +$ cd .. +$ cd .. +$ cd ndw +$ ls +241303 bht.rpj +173068 vqgsglwq +$ cd .. +$ cd nlml +$ ls +228982 hzglfpvq.ftt +114981 sgwz.cdz +$ cd .. +$ cd pcbt +$ ls +dir bsltmjz +dir ffpzc +dir fjsjwfg +dir fwm +dir jvwt +227943 tmr.jdc +dir vwpqzdwh +31258 wjlmgq +$ cd bsltmjz +$ ls +177750 bsltmjz.spj +dir ffpzc +dir flrpwfs +138824 mtmdtcpv.cfj +165770 wzqwczj.qwn +$ cd ffpzc +$ ls +179645 snjntth.dss +$ cd .. +$ cd flrpwfs +$ ls +60566 wvjq.gmm +$ cd .. +$ cd .. +$ cd ffpzc +$ ls +97847 qzhhtmd.bhw +1197 vqgsglwq +$ cd .. +$ cd fjsjwfg +$ ls +152232 dnsdd.jgz +181301 gsb.wsh +dir jqpb +dir jscbg +dir snjntth +227677 snjntth.vvg +dir sphbzn +75358 vqgsglwq +2589 wjlmgq +$ cd jqpb +$ ls +253403 mmnvqn.hqb +108325 rvq.mrc +$ cd .. +$ cd jscbg +$ ls +dir dtm +dir gsdnz +208269 prh +25977 qdzljgh +169262 vmnq.mth +$ cd dtm +$ ls +80072 gzqnb +$ cd .. +$ cd gsdnz +$ ls +dir dsqzjs +297895 sgwz.cdz +129983 vqgsglwq +$ cd dsqzjs +$ ls +2621 jqrlsf.gzs +164844 snjntth +$ cd .. +$ cd .. +$ cd .. +$ cd snjntth +$ ls +118553 cbhql +dir ffpzc +dir snjntth +$ cd ffpzc +$ ls +dir lmn +12104 tvlwn.vhh +$ cd lmn +$ ls +46401 bsltmjz +96888 shrnqhvq +$ cd .. +$ cd .. +$ cd snjntth +$ ls +dir snjntth +dir vlnfhbq +dir wpwl +$ cd snjntth +$ ls +dir ctj +$ cd ctj +$ ls +82485 fcsjl.lfl +$ cd .. +$ cd .. +$ cd vlnfhbq +$ ls +250106 qvf +$ cd .. +$ cd wpwl +$ ls +153950 cmsd.rlg +$ cd .. +$ cd .. +$ cd .. +$ cd sphbzn +$ ls +dir glgq +$ cd glgq +$ ls +285182 wjlmgq +$ cd .. +$ cd .. +$ cd .. +$ cd fwm +$ ls +251865 ffpzc.qgb +279522 zvvpfqtp +$ cd .. +$ cd jvwt +$ ls +48990 bsltmjz.nzp +219604 ffpzc +69573 mvmdfzr.lwb +$ cd .. +$ cd vwpqzdwh +$ ls +267581 pvcch +$ cd .. +$ cd .. +$ cd .. +$ cd tbgjpphc +$ ls +255571 dstpcgr.tfq +dir fdbwbrpp +dir gjzwh +dir hjvrtjt +dir rhzczj +292888 sgwz.cdz +dir wlzhr +149395 wnfzrqgz.dtn +$ cd fdbwbrpp +$ ls +dir ffpzc +dir qbrth +51164 qprp +dir slpt +117026 sphbzn +295685 vqgsglwq +dir znmj +$ cd ffpzc +$ ls +dir jhnzrdvb +$ cd jhnzrdvb +$ ls +217775 ffpzc.sgw +$ cd .. +$ cd .. +$ cd qbrth +$ ls +183969 lpbwgfjv.vcg +47333 wjlmgq +$ cd .. +$ cd slpt +$ ls +32343 tqhtj.jwz +$ cd .. +$ cd znmj +$ ls +55058 mmnvqn.hqb +$ cd .. +$ cd .. +$ cd gjzwh +$ ls +dir dvcbcd +202530 dzdfc.vqq +dir fsgz +dir hfrrqq +54897 jlzn.qsn +16097 ldzqsbb.jzl +225078 pswccrd +dir rqqmldw +292464 rzrdhbp.vld +dir ssqbqqp +dir zsztqrc +$ cd dvcbcd +$ ls +187837 dzdfc.vqq +dir jlwtvf +dir jnjvshs +164053 nrf.fqd +5665 tlp.jmt +13801 wjlmgq +$ cd jlwtvf +$ ls +219985 sphbzn.dvj +$ cd .. +$ cd jnjvshs +$ ls +dir bsltmjz +dir nrpm +$ cd bsltmjz +$ ls +152972 qgdqj +$ cd .. +$ cd nrpm +$ ls +18509 wjlmgq +$ cd .. +$ cd .. +$ cd .. +$ cd fsgz +$ ls +224576 mmnvqn.hqb +$ cd .. +$ cd hfrrqq +$ ls +dir bwgsnfvb +dir fcsjl +294608 ffpzc.gvm +136880 qjcgtw +dir sphbzn +$ cd bwgsnfvb +$ ls +29735 dzdfc.vqq +dir wstmzfml +$ cd wstmzfml +$ ls +158447 bnvhbvvc.nrt +59889 jclclgd +$ cd .. +$ cd .. +$ cd fcsjl +$ ls +138297 ffpzc.szw +$ cd .. +$ cd sphbzn +$ ls +dir wqdths +$ cd wqdths +$ ls +8326 cgvtw.jpz +$ cd .. +$ cd .. +$ cd .. +$ cd rqqmldw +$ ls +226757 dzdfc.vqq +115055 mwb.btc +dir qpts +298524 sgwz.cdz +$ cd qpts +$ ls +60860 bsltmjz.frp +dir fcsjl +94904 sgwz.cdz +dir wnmqqspz +$ cd fcsjl +$ ls +25082 mmnvqn.hqb +$ cd .. +$ cd wnmqqspz +$ ls +165529 sgwz.cdz +$ cd .. +$ cd .. +$ cd .. +$ cd ssqbqqp +$ ls +192477 pvrgm +$ cd .. +$ cd zsztqrc +$ ls +254053 lht.htn +$ cd .. +$ cd .. +$ cd hjvrtjt +$ ls +189942 fwps +$ cd .. +$ cd rhzczj +$ ls +36502 bmtfr +dir ffjz +35148 nctfhmzm.vsz +dir qdgjzcz +208196 rwql +79863 sgwz.cdz +dir snjntth +$ cd ffjz +$ ls +dir grsvhwm +$ cd grsvhwm +$ ls +50231 fwj.rdv +dir snjntth +$ cd snjntth +$ ls +dir dtbgb +$ cd dtbgb +$ ls +150245 vdflm.lmq +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd qdgjzcz +$ ls +222389 dzdfc.vqq +$ cd .. +$ cd snjntth +$ ls +56794 mmnvqn.hqb +$ cd .. +$ cd .. +$ cd wlzhr +$ ls +116628 bsltmjz +60122 jqpbsgnr.fgb +252605 lfss +300065 qwjdl.vhr +$ cd .. +$ cd .. +$ cd .. +$ cd pwtpltr +$ ls +dir dplsvrhl +140951 gwtfzqvd.znb +dir jbvdb +dir jst +dir qhjv +dir snjntth +$ cd dplsvrhl +$ ls +272101 fcsjl +dir ffpzc +58852 mmnvqn.hqb +dir mnhntjz +91899 sgwz.cdz +228077 snjntth.btv +$ cd ffpzc +$ ls +5499 bsltmjz +dir qmfwpjhl +dir rsrb +dir wgt +$ cd qmfwpjhl +$ ls +300362 dzdfc.vqq +$ cd .. +$ cd rsrb +$ ls +252983 dzdfc.vqq +107744 ltssrgqb.zvj +214895 rhglgcwr.wpw +249727 sgwz.cdz +$ cd .. +$ cd wgt +$ ls +141984 dzdfc.vqq +194686 mmnvqn.hqb +258023 pgr +$ cd .. +$ cd .. +$ cd mnhntjz +$ ls +dir bdvght +dir jprwchh +dir snjntth +$ cd bdvght +$ ls +243166 vpsvjdq.wsn +$ cd .. +$ cd jprwchh +$ ls +178943 bmpc.bjb +$ cd .. +$ cd snjntth +$ ls +dir nlbm +dir zjmjntff +$ cd nlbm +$ ls +33050 fcsjl.rcc +dir sphbzn +17446 wjlmgq +$ cd sphbzn +$ ls +214563 prrfhff.pbp +$ cd .. +$ cd .. +$ cd zjmjntff +$ ls +82134 sgwz.cdz +52203 vrtlgdq.crp +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd jbvdb +$ ls +dir wmtjh +$ cd wmtjh +$ ls +dir ggvwn +$ cd ggvwn +$ ls +192285 spqvmf.sdh +$ cd .. +$ cd .. +$ cd .. +$ cd jst +$ ls +dir bsltmjz +212740 dzdfc.vqq +dir gncztvtb +dir jsqjcqnt +286257 jvs +36654 sdcsm.mbg +192040 sgwz.cdz +dir tbqphzb +dir vdcqgts +285843 wjlmgq +$ cd bsltmjz +$ ls +215705 snjntth.gpv +213665 wjlmgq +$ cd .. +$ cd gncztvtb +$ ls +229298 vqgsglwq +$ cd .. +$ cd jsqjcqnt +$ ls +dir bsltmjz +dir fcsjl +dir ffpzc +dir sphbzn +70864 vqgsglwq +$ cd bsltmjz +$ ls +14981 pqzffzjc +$ cd .. +$ cd fcsjl +$ ls +140328 jwhczwbc +$ cd .. +$ cd ffpzc +$ ls +213650 mmnvqn.hqb +$ cd .. +$ cd sphbzn +$ ls +dir psmtphhq +dir sphbzn +$ cd psmtphhq +$ ls +dir ffpzc +123131 tzgwd +$ cd ffpzc +$ ls +49737 cfngvmd +dir gcnrp +172799 gmd.cwl +dir llnztjf +dir nbqs +79661 rrqz +$ cd gcnrp +$ ls +283 vqnrgl.vwp +$ cd .. +$ cd llnztjf +$ ls +63263 tjhm.bwh +$ cd .. +$ cd nbqs +$ ls +dir vssmq +$ cd vssmq +$ ls +88980 dzdfc.vqq +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd sphbzn +$ ls +20140 fcsjl.zrs +260579 snjntth +$ cd .. +$ cd .. +$ cd .. +$ cd tbqphzb +$ ls +93470 sgwz.cdz +$ cd .. +$ cd vdcqgts +$ ls +223564 dzdfc.vqq +dir ffpzc +dir gwhfgwf +dir nbjtqnng +dir snjntth +$ cd ffpzc +$ ls +42813 qwwmw.nmt +$ cd .. +$ cd gwhfgwf +$ ls +59918 jvfv.mpm +dir mjl +211039 pcwl +$ cd mjl +$ ls +13004 pgjb.tpq +195995 tms.fjz +$ cd .. +$ cd .. +$ cd nbjtqnng +$ ls +107058 dzdfc.vqq +dir ldrsd +111631 vqgsglwq +104599 wbzmdljw.tjq +155747 wjlmgq +$ cd ldrsd +$ ls +107439 jvjm +$ cd .. +$ cd .. +$ cd snjntth +$ ls +242680 fgrt.gng +$ cd .. +$ cd .. +$ cd .. +$ cd qhjv +$ ls +dir bmnm +68453 hjjpdgn.hwl +dir sjlbj +dir vqnrj +$ cd bmnm +$ ls +1238 vqgsglwq +$ cd .. +$ cd sjlbj +$ ls +44239 wzzbtmrz.gml +$ cd .. +$ cd vqnrj +$ ls +3286 bsltmjz.qlc +$ cd .. +$ cd .. +$ cd snjntth +$ ls +130833 blm.wmt +dir snjntth +dir tcnmbcgg +218869 wjlmgq +$ cd snjntth +$ ls +dir snmrdfbt +$ cd snmrdfbt +$ ls +281025 bzrsds.lfg +$ cd .. +$ cd .. +$ cd tcnmbcgg +$ ls +194998 fcsjl +dir qdrmpqgn +dir rzqd +dir tcsds +$ cd qdrmpqgn +$ ls +165713 qmzgt.tnc +$ cd .. +$ cd rzqd +$ ls +dir cwhnmlv +57819 fcsjl +246864 pjnzdvd.gjm +$ cd cwhnmlv +$ ls +287539 mmnvqn.hqb +215636 pbnjt.zbn +124638 sqd +$ cd .. +$ cd .. +$ cd tcsds +$ ls +78812 gfmgb.wqj +218987 hnhfvz.dln +209640 mzzhqlq.zqp +102492 nml.ppg +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd szn +$ ls +dir fcsjl +dir snjntth +dir zjbp +$ cd fcsjl +$ ls +158019 jsv.pmz +$ cd .. +$ cd snjntth +$ ls +229510 dfvpvp +191061 fgplbptq.jlt +dir lfb +234911 lfsrwr.wcb +dir lrfcgzl +48031 stbbw +219691 vqgsglwq +dir zshh +$ cd lfb +$ ls +dir btj +99591 dhrjbvvg.gwm +137224 dzdfc.vqq +201972 jtzmqsvj.wnd +9704 mmnvqn.hqb +dir pwg +200308 snjntth.css +dir wcmhcfm +dir zwhvmln +$ cd btj +$ ls +dir rnbzdfgn +51799 wdhsm +dir wvf +$ cd rnbzdfgn +$ ls +117095 bsltmjz.tlv +$ cd .. +$ cd wvf +$ ls +dir ffpzc +dir ncbmgpsc +dir wtwrmjnt +$ cd ffpzc +$ ls +249919 lsth.fmf +$ cd .. +$ cd ncbmgpsc +$ ls +147899 dzdfc.vqq +$ cd .. +$ cd wtwrmjnt +$ ls +252366 pvpdv.jwz +$ cd .. +$ cd .. +$ cd .. +$ cd pwg +$ ls +280845 fcsjl.fjz +44300 sgwz.cdz +dir snjntth +229605 vqgsglwq +$ cd snjntth +$ ls +2053 pflvsnzs +143522 sgwz.cdz +$ cd .. +$ cd .. +$ cd wcmhcfm +$ ls +229329 qsznhwlw.vjg +$ cd .. +$ cd zwhvmln +$ ls +dir ffpzc +dir tjjzbf +dir wzcq +$ cd ffpzc +$ ls +dir ncnj +37497 vqgsglwq +$ cd ncnj +$ ls +40920 htbjhjq +$ cd .. +$ cd .. +$ cd tjjzbf +$ ls +47522 mczn.spd +$ cd .. +$ cd wzcq +$ ls +56662 ffpzc.vwp +dir snjntth +$ cd snjntth +$ ls +117276 wjlmgq +$ cd .. +$ cd .. +$ cd .. +$ cd .. +$ cd lrfcgzl +$ ls +267485 rsjmpph.qqz +$ cd .. +$ cd zshh +$ ls +dir ffpzc +dir gmn +dir snjntth +150048 tgtlh +32020 thfr +72152 vqgsglwq +$ cd ffpzc +$ ls +dir snjntth +$ cd snjntth +$ ls +224945 dpfpz +$ cd .. +$ cd .. +$ cd gmn +$ ls +238996 sgwz.cdz +$ cd .. +$ cd snjntth +$ ls +86775 dzdfc.vqq +19560 vshcmjj +$ cd .. +$ cd .. +$ cd .. +$ cd zjbp +$ ls +dir fcsjl +41522 nlvpb.fpf +dir nmtjtd +$ cd fcsjl +$ ls +276802 fcsjl.psm +197934 sgwz.cdz +$ cd .. +$ cd nmtjtd +$ ls +47477 dvqmqlgw.ths +51081 vqgsglwq diff --git a/day07/examples/test.txt b/day07/examples/test.txt new file mode 100644 index 0000000..09a921e --- /dev/null +++ b/day07/examples/test.txt @@ -0,0 +1,23 @@ +$ cd / +$ ls +dir a +14848514 b.txt +8504156 c.dat +dir d +$ cd a +$ ls +dir e +29116 f +2557 g +62596 h.lst +$ cd e +$ ls +584 i +$ cd .. +$ cd .. +$ cd d +$ ls +4060174 j +8033020 d.log +5626152 d.ext +7214296 k -- cgit v1.2.3