From 4cb3fa6de434d287bb46ca94c3026880164cb774 Mon Sep 17 00:00:00 2001 From: Shivesh Mandalia Date: Sun, 5 Feb 2023 01:32:03 +0000 Subject: complete day 6 and 7 --- day06/app/Main.hs | 154 +++++++++++++++++++++++++++++++++++++++++++++++ day06/day06.cabal | 35 +++++++++++ day06/examples/input.txt | 1 + day06/examples/test0.txt | 1 + day06/examples/test1.txt | 1 + day06/examples/test2.txt | 1 + day06/examples/test3.txt | 1 + day06/examples/test4.txt | 1 + 8 files changed, 195 insertions(+) create mode 100644 day06/app/Main.hs create mode 100644 day06/day06.cabal create mode 100644 day06/examples/input.txt create mode 100644 day06/examples/test0.txt create mode 100644 day06/examples/test1.txt create mode 100644 day06/examples/test2.txt create mode 100644 day06/examples/test3.txt create mode 100644 day06/examples/test4.txt (limited to 'day06') diff --git a/day06/app/Main.hs b/day06/app/Main.hs new file mode 100644 index 0000000..68f1492 --- /dev/null +++ b/day06/app/Main.hs @@ -0,0 +1,154 @@ +{- +--- Day 6: Tuning Trouble --- + +The preparations are finally complete; you and the Elves leave camp on foot and begin to make +your way toward the star fruit grove. + +As you move through the dense undergrowth, one of the Elves gives you a handheld device. He +says that it has many fancy features, but the most important one to set up right now is the +communication system. + +However, because he's heard you have significant experience dealing with signal-based systems, +he convinced the other Elves that it would be okay to give you their one malfunctioning device +- surely you'll have no problem fixing it. + +As if inspired by comedic timing, the device emits a few colorful sparks. + +To be able to communicate with the Elves, the device needs to lock on to their signal. The +signal is a series of seemingly-random characters that the device receives one at a time. + +To fix the communication system, you need to add a subroutine to the device that detects a +start-of-packet marker in the datastream. In the protocol being used by the Elves, the start +of a packet is indicated by a sequence of four characters that are all different. + +The device will send your subroutine a datastream buffer (your puzzle input); your subroutine +needs to identify the first position where the four most recently received characters were all +different. Specifically, it needs to report the number of characters from the beginning of the +buffer to the end of the first such four-character marker. + +For example, suppose you receive the following datastream buffer: + +``` +mjqjpqmgbljsphdztnvjfqwrcgsmlb +``` + +After the first three characters (mjq) have been received, there haven't been enough characters +received yet to find the marker. The first time a marker could occur is after the fourth +character is received, making the most recent four characters mjqj. Because j is repeated, this +isn't a marker. + +The first time a marker appears is after the seventh character arrives. Once it does, the last +four characters received are jpqm, which are all different. In this case, your subroutine +should report the value 7, because the first start-of-packet marker is complete after 7 +characters have been processed. + +Here are a few more examples: + + bvwbjplbgvbhsrlpgdmjqwftvncz: first marker after character 5 + nppdvjthqldpwncqszvftbrmjlhg: first marker after character 6 + nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg: first marker after character 10 + zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw: first marker after character 11 + +How many characters need to be processed before the first start-of-packet marker is detected? + +--- Part Two --- + +Your device's communication system is correctly detecting packets, but still isn't working. It +looks like it also needs to look for messages. + +A start-of-message marker is just like a start-of-packet marker, except it consists of 14 +distinct characters rather than 4. + +Here are the first positions of start-of-message markers for all of the above examples: + + mjqjpqmgbljsphdztnvjfqwrcgsmlb: first marker after character 19 + bvwbjplbgvbhsrlpgdmjqwftvncz: first marker after character 23 + nppdvjthqldpwncqszvftbrmjlhg: first marker after character 23 + nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg: first marker after character 29 + zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw: first marker after character 26 + +How many characters need to be processed before the first start-of-message marker is detected? +-} +{-# LANGUAGE DerivingStrategies #-} +{-# OPTIONS_GHC -Wno-unrecognised-pragmas #-} +{-# HLINT ignore "Use ordNub" #-} +{-# OPTIONS_GHC -Wno-unsafe #-} + +module Main (main) where + +import Data.ByteString.Lazy (ByteString) +import Data.Discrimination (Grouping, nub) +import Data.List (findIndex, length) +import Options.Applicative (Parser, ParserInfo, argument, execParser, fullDesc, help, helper, info, metavar, str) +import Relude hiding (ByteString, elem, empty, filter, fromList, length, null, optional, readFile, splitAt) +import Text.Parsec (ParseError, parse, ()) +import Text.Parsec.ByteString.Lazy (GenParser) +import Text.Parsec.Char (anyChar, string) +import Text.Parsec.Combinator (eof, many1) +import Text.Parsec.Prim (parsecMap, try) + +type Opts :: Type +newtype Opts = Opts {_filename :: Text} deriving stock (Show) + +parseInput :: FilePath -> ByteString -> Either ParseError String +parseInput = parse $ many1 anyChar <* (eol <|> eof) + where + eol :: GenParser t st () + eol = + parsecMap + (const ()) + ( try (string "\n\r") + <|> try (string "\r\n") + <|> string "\n" + <|> string "\r" + "end of line" + ) + +window :: Int -> [a] -> [[a]] +window n xs = + if n > length xs + then [] + else take n xs : window n (drop 1 xs) + +allunique :: Grouping a => [a] -> Bool +allunique xs = nub xs == xs + +run :: Int -> String -> Maybe Int +run nchars = findIndex allunique . window nchars + +runPart1 :: String -> Int +runPart1 xs = case run nchars xs of + Nothing -> error "Failure" + Just res -> nchars + res + where + nchars :: Int + nchars = 4 + +runPart2 :: String -> Int +runPart2 xs = case run nchars xs of + Nothing -> error "Failure" + Just res -> nchars + res + where + nchars :: Int + nchars = 14 + +main :: IO () +main = do + fileName <- toString . _filename <$> execParser opts + rawInput <- readFileLBS fileName + case parseInput fileName rawInput of + Left e -> do + putTextLn "Error parsing input:" + print e + Right r -> do + print $ runPart1 r + print $ runPart2 r + where + opts :: ParserInfo Opts + opts = info (helper <*> options) fullDesc + + options :: Parser Opts + options = Opts <$> filename + + filename :: Parser Text + filename = argument str $ metavar "filename" <> help "Input file" diff --git a/day06/day06.cabal b/day06/day06.cabal new file mode 100644 index 0000000..a189f1f --- /dev/null +++ b/day06/day06.cabal @@ -0,0 +1,35 @@ +cabal-version: 2.4 +name: day06 +version: 0.1.0.0 +synopsis: + +-- A URL where users can report bugs. +-- bug-reports: +license: +author: Shivesh Mandalia +maintainer: mail@shivesh.org + +executable day06 + main-is: Main.hs + + -- Modules included in this executable, other than Main. + -- other-modules: + + -- LANGUAGE extensions used by modules in this package. + default-extensions: + NoImplicitPrelude + OverloadedStrings + StandaloneKindSignatures + + build-depends: + , base ^>=4.16.4.0 + , discrimination >=0.5 + , optparse-applicative >=0.17.0.0 + , parsec >=3.1.16.1 + , relude ^>=1.1.0.0 + + hs-source-dirs: app + default-language: Haskell2010 + ghc-options: + -Weverything -Wno-unused-packages -Wno-missing-safe-haskell-mode + -Wno-safe -Wno-missing-import-lists diff --git a/day06/examples/input.txt b/day06/examples/input.txt new file mode 100644 index 0000000..636557c --- /dev/null +++ b/day06/examples/input.txt @@ -0,0 +1 @@ +gzbzwzjwwrfftfrrbvvcbcvcffpssvhhzfzbfzzrbrtrcttnthnhsnhsnnclcpctpprwwgppppchhvvctvtsvswwcdcrrdzdhzdzvddvfvfjjlldvvfllfhlfhlhghnhghrgrsggvbbhdhffzggmttjqtjjgljjwtjwjggldlzzrfrpppjsjggqrrdbbgwgtwwwtqwtqqvccjnnhrhqqsnssjbssmjjbzjjqnqnlnjncjjzzqddfqqqnqvnqncqqmsshqqccssvpvllbbfvfmmmgzgdggtjgjtjbttngtnnhhfrfddmtmtftcftthvttwzwrzrbrgrbrqbqccmmtvtqvtqqzmzwmzzzsvzvhhhqlhqlqplpggvmvwmmshhnshsjszzljlnlrnllgddqllpmllsgswwqnqlnlqqlmqqvrqvrqrppvrrqwqhqllgjgcggsllqgllghlghhbvhhcvvbddvcvwwwzdzzfjjvcczbbwccjvccmvmfvfgfmfttwrttpmtmsszccjggcssmqsmsgszzfpphghvgvvcddtltwlwnnrbbfdbbtssrvvmwwjfflmlblwlrlmlwwhrhnhqnnvdvllzblzzndzdlzzhpprbrprnrzrjjlnlnrrjddgrrwrttcstsgshszzvgvfvpfpqfpfbpbfbwbmmzvvnnqvvqppzspzpzplldqlqsqlldmlmgmcmwmsmfsfzfdzzbpzzbbcwbbtppphlhshchjjszztctpprqppszzchcqczczddscsrstsntstjsjqjjfggvccgbggqhghrhppdldnlndnpddllgplgppnlpnnmwwglghhftfrtrqtqsszrssfjjzhzfhfssflfslsmmgrrcdrdnrdnnqznndrrbtrrmhrhbhsbsgsnslsqlqnncpccplpldpldppshsdssqdsqdsqdsdsdfsddchczhczcszcscffzhfzffpbbgttdhthnhnjnwnnwrrmwmlljzlzlzdzrrcvcbbsfstfsfnfqftqffgjfjzfjfsjswswccsvcvlccshhjpjcccnfnqqmsqmmrwmwjwswgsgjsjttmjmjttpqtqwttgmgfmmnbnrnpnwppgspggwnwqnqpqmmbmmnwnllbwwdqqzsqqtgttnrtrllcwcchpchcbhbpbnpbpsptpvtvzvrzzslljddjzjjmqmmdpmddcdzzrdrqddtctppwzzwrzrvzrvrzzjtztqqsmmcncllhmlmpmhgsrtrzjhjbtfvhmzpssfbjwcdshthnmmqmfhlhwcbbllwzbwfgfvzjcqblchzqqqgcgmpnbnnblhbcpgmvsbvtcmhsghldlhqlghgtpdvjflmjsmppdsvrjlwvhmwsmfvvdnzpmtfqjqpjdctnnrlfjfvdtmvdmhsczlfsqwfrqtlqwnzdzrcdzmhvrgwnjjtqjrqljhgcffglvhnsdssqdpfrfhtjwlqzvfjmpjnqhsjvndtstqjsqgcmgqdjvfqnlmtjlvcblndprmffrgqdnnncnlfflclgqbjbmsdqsjrmzpwtbqqqqsqmgthhjfqwzvcbqwlvdbffhcvncpldmchnptbnlbhmzrrjhzvzdrvtlhsnfnfdnvhlrlrmdcpnmvdwswctcqldszlvftqtwldrhmfjmfvcgjcdjsbjqjwdtslblwhqfvgrfcpnhszqqsfwbwcmvfvccvztdmcjqfjvdvmbdtcjvtwqpwsqjtdvpvvvsdrrvngmjztgjtnpdbmtlrbrjlwsdnthgzgpssgbzzrqvgblqhrtfbflnphvhpzmdfrwqvjjvcpsmdrqwdbzlpnqpmglgqzfhctrzdpzdthqgjtvpwcrlsmqnjwgzlnqbthvfswhjtrrsrswhbmnddgzmznvppbnmtjpzpdpmpzpmsgfstzldgmrtgplwwsbztphtcvdfgsqzqwrmlqpnhvpcqpfjpbrthrtwgqlfnrqcrpvhssjmhfgpnzzvlrlcbnpmddhtdvvfrrvprqrwbhfgvvltgrhrpwsdgvrlgthbztcgcfggtcfzqtlcdhpmcvpgcszslhpfrttnrdrqpqlgdfwtccmbhfrnlbhhmrtrjmzstbqhmtphzcpcllzsnghfvlwvzzvlqrjmfsvhrnjnvldgnbqvpjsmmphhrmhqrtcncmjwbdlqtrvmhgjrjsrddcpqnjhfmczfgwzspnrjfwvfdpdlcfpvctfrlspdwwlnpbvbglzsmgfsmrshsqgcvlfrvjssrglbwvvvgpvtqshbtqmzbnglflhhldtfzqssptrbnnzdqwqtstpftdqgmmhfjdlfwtmcmtmcgcvtfhzvsbllgbchvlhrgnvvbsnrwqrlvdqlcwwlgbjrvrzgcvljqzvdngtbhpnppjrzpmbwztzvnvrbfccfgvnqvrcmpdblngcvlwjwzpbbwmnslsdjmbrwbvnjsgcmsfvzvnwbzrrlzvgdnzcqqgggvmcwczjqnrddnzhlndgzjbvtbtjqdnlvlflqnfvjdmfstpdfqsgjdslgtpgdnvvpmfwvlqbmbgdrqjhdfhlmsdtfwpscsvdzmswszjfwqtsjqpfnjjlnsspvlgzwwtvwgdzfjjljfwbvfbvpglcqcdbdpshwcqzswbwhftbfqblzpqfmqpvzdjsrcqtvjntnhmlhmzllffcjsdnwpfzdglvlrhrljbrhjhgdnfcqcrccwrbbhrvqwrzlwjrrwzsfcwsvbqsjgtgpzqwlczljrtdhtzcgsfgqssdbjjmttdtzhrqtbqjtqfwmcpdftrfjmznpscsqmtfcdpcdjwcqjvmhngcqnmtmwfttcvpwgcnhhgnnbgjdvztzhczvqljjqwcmwcbvmqqjsfnmhtbtsvsnsfwfzgdvlctrgdvbjqpgfrrlsnppmvhfbbclprlvcssnvtsgftmlpqrpjzrrphrzltbtgfwjqqvbgqjdpdgqvzppfzcbhdbbjttcdzclsphtlzfvnfqgpmqvpzrqgpdnbmsrqgsnfdwpvndzmsllgmnrlhnnzldwshtrrsrsmdncwrcjnmcjlwbbfpzcwzvldtgvbcvhnbhgjgwjcvslrfcwbqlrqldvpcgnbwbzzncncftrgbrwchfrrtnpqsjbcpzvplnbqdgtvnnrcwwfvbdzdrsfspvtbhflhsbqmlsjvfmpvjbfvcrdmgrfqsmqgfrntfqnlqbvmsqtpncjrstspbqvfmddmhwsssdcddshmwdlscttmdzljtpwhzhzhwsdnmgjstfmlnqqvzzdqpqsjdsllswmqcjtnthwqnhbscrjdstljqgncjvjvlpfrtscrzrqghrdvdnbtnpshpldcchljzrzqjlwwscnphvrwlvzttcdjdrddgmvqpvdmttdqhwpfmslzvnrwlrrdttbhctgpgzjrmdwjbcmsprwggvmdmmltldgpbfnppnrpwcnpgtblccdvbsnfvgzmjppftvndmdslfshjvndfvvzjjlzhgfmhcggttrcrbrlwrqgjpchvhnjwqnbsnmftwszhzftglrfdvvnbcbzsslgmdchtrrrqqzhllrfhwfwbbdgfpdfwssmzcfcnzmrhfdddtdhfqmctsglqbwhwpnbdzbsfbbvvthrrgjvztjjwgjcgjntrddmmdldtmvjnwjbcqwfwvfhsrpchznhlqpcttqjffbrpbftftdjzlrqchmzrfgjrqlndfwfrghtsfsblcvtjmjrbfrwdgsgzmmjpdlbwzfscfsfcdqwdwnjwjbvvbptmfrqltmnlpbtrqspwdfmhnncqgtrtmbzhfmwrbcqhmmpmvprvwrjplspcmmspldmbgpbtmqjtrfcpfhcnpjbnlhjpzflstjqfqvzcnfgvrmtplndchffzrtfrqdpdnzrspddwmpzlfchrzzfcfvmbvfnlfwtfbvnffdqhljbvwwdtmszgrjtzwqdbgvvfphcnsdgvlmslqngfmsbrztrnpjprghmjffscbnfqwrvjjjtfzrmjtzbwdsmzgmbtjzvddhngmzvflwftblbzfd diff --git a/day06/examples/test0.txt b/day06/examples/test0.txt new file mode 100644 index 0000000..7980a82 --- /dev/null +++ b/day06/examples/test0.txt @@ -0,0 +1 @@ +mjqjpqmgbljsphdztnvjfqwrcgsmlb diff --git a/day06/examples/test1.txt b/day06/examples/test1.txt new file mode 100644 index 0000000..19fe247 --- /dev/null +++ b/day06/examples/test1.txt @@ -0,0 +1 @@ +bvwbjplbgvbhsrlpgdmjqwftvncz diff --git a/day06/examples/test2.txt b/day06/examples/test2.txt new file mode 100644 index 0000000..0f12ee2 --- /dev/null +++ b/day06/examples/test2.txt @@ -0,0 +1 @@ +nppdvjthqldpwncqszvftbrmjlhg diff --git a/day06/examples/test3.txt b/day06/examples/test3.txt new file mode 100644 index 0000000..38510e7 --- /dev/null +++ b/day06/examples/test3.txt @@ -0,0 +1 @@ +nznrnfrfntjfmvfwmzdfjlvtqnbhcprsg diff --git a/day06/examples/test4.txt b/day06/examples/test4.txt new file mode 100644 index 0000000..e1d0a43 --- /dev/null +++ b/day06/examples/test4.txt @@ -0,0 +1 @@ +zcfzfwzzqfrljwzlrfnpqdbhtmscgvjw -- cgit v1.2.3